Papilio xuthus (Asian swallowtail): 106125777 Help Entry 106125777         CDS       T07456                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism pxu  Papilio xuthus (Asian swallowtail) Pathway pxu03030   DNA replication pxu03082   ATP-dependent chromatin remodeling pxu03410   Base excision repair pxu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pxu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     106125777    03410 Base excision repair     106125777    03420 Nucleotide excision repair     106125777   09126 Chromosome    03082 ATP-dependent chromatin remodeling     106125777  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pxu03032]     106125777    03036 Chromosome and associated proteins [BR:pxu03036]     106125777    03400 DNA repair and recombination proteins [BR:pxu03400]     106125777 Enzymes [BR:pxu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      106125777 DNA replication proteins [BR:pxu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     106125777 Chromosome and associated proteins [BR:pxu03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     106125777 DNA repair and recombination proteins [BR:pxu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       106125777 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone DUF8000 TAF Motif Other DBs NCBI-GeneID:  106125777 NCBI-ProteinID:  XP_013178574 UniProt:  A0A0N0P9M8 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MAEKLEDLNLPMSVVTRIVKESLPDGVAISKEARTGLAKAASVFVLYVTSAATNIVKNHK RKTLTGPDVLEAMKDIEFDRFVGPLTEALENYKQAVSARKSGAGKKKEEAEEIETIEED NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggctgagaaactggaagatctgaatctgcccatgtctgttgtgactcggattgttaaa gaatctttacctgacggtgtagctatatcgaaagaggctcgtaccggtttagcaaaggcc gcttctgttttcgtattatacgtgacttcggcagccactaatattgttaaaaaccacaaa agaaaaacattaacaggtccagatgtcttagaagctatgaaagatatagaattcgaccga ttcgtcgggccattaactgaagcgttggaaaactacaaacaagctgtttctgcaagaaaa tctggcgctgggaagaaaaaagaagaagctgaagaaatagaaacaattgaagaagattaa

DBGET integrated database retrieval system