KEGG   Papilio xuthus (Asian swallowtail): 106128317
Entry
106128317         CDS       T07456                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
pxu  Papilio xuthus (Asian swallowtail)
Pathway
pxu00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pxu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106128317
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pxu00199]
    106128317
Enzymes [BR:pxu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     106128317
Cytochrome P450 [BR:pxu00199]
 Cytochrome P450, animal type
  CYP306 family
   106128317
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 106128317
NCBI-ProteinID: XP_013182088
LinkDB
Position
Unknown
AA seq 546 aa
MQGCNPKMDFLFLWLVTFVLGYWICKKIKEWRSLPPGPWGLPIVGFLPYIDRNQPHLTLT
NVAKQFGPIYGISMGSIYTVVLSDHKLVREAFAKDAFSGRAPLYLTHGIMHGKGIICAEG
GLWKDQRKLLTMWLKSFGTSKYSVSREKLERRIAVGVTELLQNVKQASGSPIDLPSMLAN
SLGNVVNEIIFGYKYPSDDKTWNWFRQIQEEGSHEMGVAGVVNFLPFIRFFSKSVQHTMK
ILLRGQAQTHSLYAAIIERRRKVLKLEAPQGAKYSLHENLFKQHPKGFIKCIKYSKHASE
LEEHYFDPEILIPSDGECILDNFLLEQKKRFDNGDETAKNMTDEQMFYLLADMFGAGLDT
TSTTLAWFLLYMSLHPEEQETVRREILSVLIDDNDCDYTKLPRLMAAICETQRIRSIVPV
GIPHGCTEDTYLGEYRIPKGTMVMPLQWAMHMDPDAWEDPEEFKPSRFLDEDGNLLKPQQ
FIPFQTGKRMCPGDELSRMMSCGLITRLFRHMRVQLADEPPTEEEMQGTVGVTLTPPKKL
YVCVPL
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgcaagggtgcaatcccaagatggatttcttatttttatggctagttactttcgtactt
ggatattggatttgtaagaagatcaaggaatggcgcagcttacctccgggtccttgggga
ttgcccatcgtgggattcttgccatacattgaccggaatcagcctcatctgactttaacg
aacgttgctaaacaattcggtccaatatatggaatatcaatgggtagtatttacacggtt
gtgttgtccgaccacaaattagttagagaagctttcgccaaggatgcattctctggacga
gccccactttatttgacccatgggatcatgcatggaaaaggtataatttgtgctgagggt
ggattatggaaggatcaacgtaagctgttgacgatgtggttgaaaagttttggtacgagc
aaatacagtgtgtcccgcgagaagttggagcgacgcattgcggtcggcgttaccgaactc
ttacaaaatgttaaacaagcttccggaagtccaattgatctaccatctatgctagcaaat
tcacttgggaacgtcgtgaatgagattatatttggttacaaatatccctctgacgacaaa
acatggaactggtttagacaaatacaagaagaaggtagtcatgaaatgggcgtagccgga
gtggttaactttttgccttttattcgatttttttcaaaatccgttcaacatacgatgaaa
attctattacgtggtcaagcccaaactcactcactttacgccgctatcattgaaaggcga
cgcaaagttctaaaacttgaagctccccaaggtgctaaatattccttacatgaaaatctg
ttcaagcagcaccccaaaggatttataaaatgtataaagtacagcaaacacgcgtctgaa
ttggaggaacattacttcgatcccgaaattcttataccatcagatggtgaatgtattcta
gacaatttcctcttggaacaaaagaaacgtttcgacaacggcgatgagactgcaaagaac
atgacagatgaacagatgttttatctgctcgcagacatgttcggggcaggccttgatacc
acgtcgactactctcgcctggtttttgttgtatatgtctctgcacccggaagaacaggag
actgtacgtcgcgagatcttatccgttttaattgacgataatgattgcgattatacaaag
ttaccacgtctaatggcggccatttgtgagacgcagcgcattcgatctatagtgcccgtc
ggcattcctcatggatgcactgaagatacatatttaggcgagtacagaattccgaaaggc
actatggtaatgccgctgcagtgggcaatgcacatggaccctgacgcatgggaagatccc
gaggagtttaaacccagtcggttcttagatgaagatggaaatttactgaagccgcaacaa
ttcataccttttcaaacagggaagcgaatgtgtcctggagatgaactttctcgtatgatg
tcgtgtggtttgataactcgcttgttccgtcacatgcgtgtacaattagccgatgaacct
cccactgaagaggaaatgcaaggtactgtcggggtcacattgacgccgccaaaaaaattg
tatgtctgtgtaccgctttaa

DBGET integrated database retrieval system