Plutella xylostella (diamondback moth): 105391030 Help Entry 105391030         CDS       T03915                                  Name (RefSeq) dynein axonemal light chain 4   KO K10412   dynein axonemal light chain 4 Organism pxy  Plutella xylostella (diamondback moth) Pathway pxy04814   Motor proteins Brite KEGG Orthology (KO) [BR:pxy00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     105391030  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pxy03037]     105391030    04812 Cytoskeleton proteins [BR:pxy04812]     105391030 Cilium and associated proteins [BR:pxy03037]  Motile cilia and associated proteins   Dynein arm    105391030 Cytoskeleton proteins [BR:pxy04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      105391030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  105391030 NCBI-ProteinID:  XP_048479427 LinkDB All DBs Position 10:complement(1336178..1339738) Genome browser AA seq 105 aa AA seqDB search MGDEGAVTGTGAEKIIHTYPLIRHSDMTEEMRTEAVELSVTACEKFATNNELAARMVKEA MDKKFGPAFHVVIGESFGFEVSYECTTICYLYFGGNQAICIWKCS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggagacgagggagcggtgaccggcaccggggcggagaaaatcatccacacatacccg ctgataaggcactcggacatgacagaagagatgcgaacagaagcggtggagctgtcagtg acggcttgcgagaagtttgccaccaataacgagctggcagctcgcatggtcaaggaggct atggacaagaagtttgggccagccttccacgtcgtgatcggagagagcttcggcttcgag gtcagctacgagtgcaccacaatatgctacctctattttggcgggaaccaggccatttgt atatggaagtgctcgtga

DBGET integrated database retrieval system