Pyrococcus kukulkanii: TQ32_01105 Help Entry TQ32_01105        CDS       T04365                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pyc  Pyrococcus kukulkanii Pathway pyc03010   Ribosome Brite KEGG Orthology (KO) [BR:pyc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TQ32_01105   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TQ32_01105  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pyc03011]     TQ32_01105    04121 Ubiquitin system [BR:pyc04121]     TQ32_01105   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyc04147]     TQ32_01105 Ribosome [BR:pyc03011]  Ribosomal proteins   Eukaryotes    Small subunit     TQ32_01105   Archaea     TQ32_01105 Ubiquitin system [BR:pyc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TQ32_01105 Exosome [BR:pyc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TQ32_01105   Exosomal proteins of colorectal cancer cells    TQ32_01105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_NUD Zn_ribbon_Nudix Zn_ribbon_RPB9 Zn_Ribbon_1 MqsA_antitoxin Motif Other DBs NCBI-ProteinID:  AMM53249 UniProt:  A0A127B8Z0 LinkDB All DBs Position 218292..218444 Genome browser AA seq 50 aa AA seqDB search MGQKWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGKCGYTEWKK NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgggacagaagtggaagctctacatagttaaggacggaaaagtcataaggaagaacaaa ttctgccccaggtgtggtcctggagtgttcatggctgatcacggtgacaggtgggcctgt ggcaagtgtggctacactgagtggaagaagtga

DBGET integrated database retrieval system