Paracoccus yeei: A6J80_02730 Help Entry A6J80_02730       CDS       T04781                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pye  Paracoccus yeei Pathway pye01100   Metabolic pathways pye01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pye00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A6J80_02730    00074 Mycolic acid biosynthesis     A6J80_02730   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A6J80_02730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ARC35442 UniProt:  A0A1V0GNL5 LinkDB All DBs Position complement(65024..65257) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVDEDKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIQGAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgatcgcgtgaagaaaatcgtcgtcgagcacctgggcgtggacgag gacaaggtgacggaaagcgcctcgttcatcgacgacctcggcgccgactcgctcgacacg gtcgagctggtcatggccttcgaggaagaattcggcatcgaaatccccgatgacgcggcc gaaaccatccagaccttcggcgatgcggtgaagttcatccagggcgcggtctga

DBGET integrated database retrieval system