Paracoccus yeei: A6J80_09435 Help Entry A6J80_09435       CDS       T04781                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism pye  Paracoccus yeei Brite KEGG Orthology (KO) [BR:pye00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pye03036]     A6J80_09435    03400 DNA repair and recombination proteins [BR:pye03400]     A6J80_09435 Chromosome and associated proteins [BR:pye03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     A6J80_09435 DNA repair and recombination proteins [BR:pye03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       A6J80_09435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS ACDH-11_C GPW_gp25 Motif Other DBs NCBI-ProteinID:  ARC36573 UniProt:  A0A1V0GRW3 LinkDB All DBs Position 1426171..1426482 Genome browser AA seq 103 aa AA seqDB search MELDLDKMSLRDLRDLRSKVDKAIATFEDRRKREALSAVENAAREFGFSLAELASAKGAG RGRVAAKYANPEDPNATWTGRGRKPRWVQEALDAGKSLEDLQI NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggaactcgacctggacaagatgtcgttgcgcgatctgcgcgatctgcgcagcaaggtg gacaaggccatcgccactttcgaggaccgccgcaaacgcgaagccctgagcgcggtggaa aatgccgcccgcgaattcggcttcagcctggcggaactggccagcgcgaaaggcgccgga cgcggccgggtcgcggcgaaatacgccaaccccgaggatccgaacgcgacctggaccggg cgtggccgcaagccccgttgggtacaagaggcactggatgccggcaagtccttggaagac ctgcaaatctga

DBGET integrated database retrieval system