Paenibacillus yonginensis: AWM70_01290 Help Entry AWM70_01290       CDS       T04810                                  Name (GenBank) DNA replication protein DnaD   KO K03116   sec-independent protein translocase protein TatA Organism pyg  Paenibacillus yonginensis Pathway pyg03060   Protein export pyg03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pyg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AWM70_01290  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AWM70_01290  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pyg02044]     AWM70_01290 Secretion system [BR:pyg02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AWM70_01290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ANS77031 UniProt:  A0A1B1N6H3 LinkDB All DBs Position 296831..297061 Genome browser AA seq 76 aa AA seqDB search MIGGGVSVLENLLRPSHLLLLAIAALLLFGPSKLPELGRGFGTMLREFRRSIRGDAAGNK QPETGAVIEDTVQEKK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgattggaggaggggtatctgtgcttgaaaatctgcttcgcccatcccacctgcttctg ctggctatagcggccctgctgctgttcgggccaagtaaacttcctgagcttggacgcggc tttggcacgatgctccgggaattcagacggagtatccgcggggatgcagcaggaaataag cagccggaaacaggtgcggttattgaggatacggtgcaagagaagaaatga

DBGET integrated database retrieval system