KEGG   Paenibacillus yonginensis: AWM70_01720
Entry
AWM70_01720       CDS       T04810                                 
Name
(GenBank) sulfate transporter
  KO
K03321  sulfate permease, SulP family
Organism
pyg  Paenibacillus yonginensis
Brite
KEGG Orthology (KO) [BR:pyg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pyg02000]
    AWM70_01720
Transporters [BR:pyg02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   AWM70_01720
SSDB
Motif
Pfam: Sulfate_transp STAS STAS_2 MFS_MOT1
Other DBs
NCBI-ProteinID: ANS73457
UniProt: A0A1B1MWD9
LinkDB
Position
395137..396915
AA seq 592 aa
MKWSGRYQHYTGEAFRRDLIAGGIVGIVAIPLGMAFAIASGVKPEYGLYTTIVAGILISL
FGGSKFQIGGPTGAFIPVLLGIVMQYGYQDLLIAGFMGGVILLLMGVLRLGFLIRYIPKP
VTIGFTAGIAVTIFSGQIGNFLGLTGVKRHEYFLGSMRELWDRLPTWNLYSVLTAAICLA
ALLITPKLLPKLPASMVGLLLSTAAALWLYPGQVATIGSAYGTIPGGLPVIHGLDLSASH
LLRLLEPALIIAMLGSIESLLSAVVADGMSGTRHNSNRELLGQGIANIVTPFFGGIPATG
AIARTATNIRSAAASPLSGIVHGIVVLLIVALFAPYASNIPLASMAPVLMMVAWNMSERK
AFVKMLKTRTGDSVILLVTFFLTVFTTLTTAVEAGLLLAAVLFIWGMSRSLVMHKALPDA
AHGERKMQALQPDRHHDCPQIAIFSVNGALFFGAATAFEEEGSELAKHPLGCVILRMSRV
PFMDTTGEAQFTELVRKLQDKGTTVLVAGLNRQPKEMLTKTGGYARLGDRHCFEHTGEAL
DFALSRVDRPTCKGCRQFAFRECASLCKAEGETAGFAVPGSAGPSVQKPGTI
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgaagtggagtggacgttatcagcattacaccggggaagcgtttagaagggatctgatc
gcagggggcattgtcggcattgtcgcgattccgctgggcatggcctttgccatcgcctcg
ggcgtcaaaccggaatatgggctgtatacgacaattgtagcgggtattcttatttctttg
tttggaggttcgaagtttcagatcggcggtcctacaggtgcctttattccggtgctgctt
ggcatcgtgatgcaatacgggtatcaggatctgttgatcgccggttttatgggcggcgtt
attctgctgctgatgggggtgctgcggctgggattcctgatccgctatatccccaaaccc
gtgacgattggatttacggcggggatcgccgtgacgattttctcgggacaaatcgggaat
ttcctggggcttaccggcgtcaagcggcatgaatatttcctcgggagcatgcgggagctc
tgggaccggcttcccacctggaatttgtacagcgtgctcaccgccgcgatttgtctggcg
gctctgttgatcactccgaagctgctgcctaagctgccggcgtccatggtggggctgctg
ctgtcgaccgcggctgcgctttggctttatcccggtcaagtggcaaccatcggttcggca
tacggtacaattcccggcggactgccggtgattcacgggctggatttatcagcgtctcat
ctgctgcggctgctggagccggcgctgatcatcgcgatgctgggcagcatcgaatcgctg
ctgtcagccgttgtcgcagacggtatgagcggtacacgccataacagcaaccgcgagctg
cttgggcagggtatcgctaatatagttacgcctttctttggcgggattcccgccacgggc
gccattgcccggacggcaaccaatatccgcagcgcagcggcatccccgctttctgggatt
gtgcacgggattgtggtgctgctgattgttgcgttgtttgcaccctatgcctccaacatc
cctttggcgagcatggcgcctgtattgatgatggtggcctggaatatgagcgaacgcaaa
gcatttgtcaaaatgctgaagacccgcaccggcgattcggttattttgctggtaaccttc
tttcttaccgtattcaccaccttgacgacagcggtggaagccgggctgctgctggcggcc
gttttgtttatttgggggatgagccgttcgcttgtcatgcataaagcgctgccagacgcg
gcgcacggcgaacgcaaaatgcaagcgctgcagccagaccgccaccatgattgtccgcag
atcgcgatcttcagcgtcaatggggcgctgttcttcggcgcagccacagcttttgaggag
gaaggcagcgaactggccaaacacccgctgggctgcgtcattctgcggatgagccgggtg
ccgtttatggacacgacgggggaagctcagttcacagagctggtgcgaaagctgcaggat
aaaggcacaaccgtgctggtggcgggactaaaccgccagccgaaggaaatgctgacgaaa
acgggtggttatgcgcggcttggcgaccgccactgctttgaacataccggcgaagcgctc
gacttcgccttgtccagagtggaccggccgacctgcaaaggctgccgtcaattcgcgttc
cgggaatgtgcttctttgtgcaaagcagaaggagagacggctggatttgccgttccgggt
tcggcggggccttcggtacagaagccgggcactatttaa

DBGET integrated database retrieval system