KEGG   Paenibacillus yonginensis: AWM70_16205
Entry
AWM70_16205       CDS       T04810                                 
Name
(GenBank) sigma factor SigB regulation protein RsbQ
  KO
K19707  sigma-B regulation protein RsbQ
Organism
pyg  Paenibacillus yonginensis
Brite
KEGG Orthology (KO) [BR:pyg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pyg03021]
    AWM70_16205
Transcription machinery [BR:pyg03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     AWM70_16205
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Abhydrolase_4 T3SS_SCTL
Other DBs
NCBI-ProteinID: ANS75937
UniProt: A0A1B1N3E1
LinkDB
Position
complement(3562098..3562937)
AA seq 279 aa
MDNQQILVRNNVHVTGCGSKAIIFAHGFGCDQSMWRFVAPAFEEKYKVLLFDFVGSGKSD
ISAFDPSVYRDLNGYAQDILDICAALDLKDAYLVGHSVGATIGLLSSIQRPDYFDRLVLI
GPSARYLNDLPDYIGGFEREDLLELLDMMDQNYQGWAGYLAPVIMGNQDRPELSKELEES
FCTTDPRAARSFAEATFLSDYRKELAKVVIPALVLQCSDDLIAPLEAGAYVHQQLKDSQF
KLMDATGHCPHVSHPEETVGLISEYFASVESLQESEKSF
NT seq 840 nt   +upstreamnt  +downstreamnt
atggataaccaacagattctcgtccggaataatgttcatgtaacaggctgtggttccaag
gctattatattcgcccacggttttggctgtgatcagagcatgtggcgttttgtagcaccc
gcttttgaagagaaatacaaggtgttattgtttgactttgtaggttcggggaagtccgat
atcagtgcctttgatccttctgtgtatcgtgacttaaatggttatgctcaagatatcctg
gatatttgtgcagcgcttgatttgaaggatgcctatctcgtgggccactcggtcggagcg
actatcggtttactttcctctattcaaaggccggattactttgaccggcttgttctgatt
ggaccgtctgcacgttatttaaatgatttgccggattacatcggaggatttgaacgggaa
gatctactggaattgctcgacatgatggatcaaaattatcagggttgggcgggttatttg
gctcctgtgattatggggaatcaagaccggccagagttatccaaggagctggaggaaagt
ttctgcacaactgatcctcgggcagcacgcagttttgctgaagctacttttctctctgat
taccgtaaggaactggccaaggtggtcattcctgcgttagttctgcaatgctccgatgat
ttgatagctccgctggaagctggagcctacgtccatcagcaactgaaggacagccaattt
aaattgatggatgcaaccgggcattgtccgcacgtaagtcatccggaagaaacagttgga
ctcatcagcgaatattttgcttcagtggaatctttgcaggaaagcgagaagtccttttag

DBGET integrated database retrieval system