Paenibacillus yonginensis: AWM70_18835 Help Entry AWM70_18835       CDS       T04810                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pyg  Paenibacillus yonginensis Brite KEGG Orthology (KO) [BR:pyg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pyg03032]     AWM70_18835    03036 Chromosome and associated proteins [BR:pyg03036]     AWM70_18835    03400 DNA repair and recombination proteins [BR:pyg03400]     AWM70_18835 DNA replication proteins [BR:pyg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AWM70_18835 Chromosome and associated proteins [BR:pyg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AWM70_18835 DNA repair and recombination proteins [BR:pyg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AWM70_18835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  ANS76374 UniProt:  A0A1B1N4M2 LinkDB All DBs Position complement(4127032..4127304) Genome browser AA seq 90 aa AA seqDB search MNKQDLINNIAGKSGLTKRDVEVVLNGLLSEITDALSGGDKVQLIGFGTFETRKRSGRTG RNPQTGGTIEIPEANVPAFKAGNKLKEAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaagatctgatcaacaatattgcaggcaaaagcggcttgactaaacgtgac gttgaagttgtgctcaacggcctgctcagcgaaattaccgatgctctttccggcggcgac aaagttcagctgatcggcttcggcactttcgaaactcgcaagcgttccggacgtaccggc cgcaacccgcaaacaggcggcacaattgaaatcccagaagcaaacgttcctgctttcaaa gcgggcaacaaacttaaagaagctgttaagtaa

DBGET integrated database retrieval system