Pseudomonas yamanorum: AK972_5480 Help Entry AK972_5480        CDS       T05821                                  Name (GenBank) Acyl carrier protein (ACP1)   KO K02078   acyl carrier protein Organism pym  Pseudomonas yamanorum Pathway pym01100   Metabolic pathways pym01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pym00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AK972_5480    00074 Mycolic acid biosynthesis     AK972_5480   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AK972_5480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMW86280 UniProt:  A0A145X7F6 LinkDB All DBs Position 6090481..6090750 Genome browser AA seq 89 aa AA seqDB search MSNPHSLEHDIKTLIIEALGLEDISESDIGNEQTLFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFTNVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccacacagccttgagcacgacataaaaacgctgatcatcgaggccctgggc ctggaagacatcagcgagagcgacatcggcaacgagcaaaccctgttcggcgaaggcctt ggcctggattcagtcgacgccctggaattgggcctggcgatccagaaaaagtacggcatc aagatcgatgccgacgccaaggacacccgtaatcacttcaccaacgtggccagcctcgcg gcgttcgtcacggcccgacaggcagcttga

DBGET integrated database retrieval system