Pyrococcus sp. NA2: PNA2_0895 Help Entry PNA2_0895         CDS       T01487                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pyn  Pyrococcus sp. NA2 Pathway pyn03010   Ribosome Brite KEGG Orthology (KO) [BR:pyn00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     PNA2_0895   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     PNA2_0895  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pyn03011]     PNA2_0895    04121 Ubiquitin system [BR:pyn04121]     PNA2_0895   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyn04147]     PNA2_0895 Ribosome [BR:pyn03011]  Ribosomal proteins   Eukaryotes    Small subunit     PNA2_0895   Archaea     PNA2_0895 Ubiquitin system [BR:pyn04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    PNA2_0895 Exosome [BR:pyn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PNA2_0895   Exosomal proteins of colorectal cancer cells    PNA2_0895 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_NUD YOR011W-A Zn_ribbon_RPB9 Zn_Ribbon_1 MqsA_antitoxin Motif Other DBs NCBI-ProteinID:  AEC51811 LinkDB All DBs Position complement(808081..808236) Genome browser AA seq 51 aa AA seqDB search MGQKWKLYIVKDGKVIRKNKFCPRCGPGVFMADHGDRWACGRCGYTEWKKK NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgggccagaagtggaagctttatatagtgaaggacggaaaggtcatcaggaaaaataaa ttctgcccaagatgtggcccgggagtcttcatggcggatcatggcgataggtgggcatgc gggaggtgtggatacacggaatggaagaagaagtga

DBGET integrated database retrieval system