Herpailurus yagouaroundi (jaguarundi): 121009729
Help
Entry
121009729 CDS
T07555
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
pyu
Herpailurus yagouaroundi (jaguarundi)
Pathway
pyu03050
Proteasome
pyu05010
Alzheimer disease
pyu05012
Parkinson disease
pyu05014
Amyotrophic lateral sclerosis
pyu05016
Huntington disease
pyu05017
Spinocerebellar ataxia
pyu05020
Prion disease
pyu05022
Pathways of neurodegeneration - multiple diseases
pyu05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
pyu00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
121009729 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
121009729 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
121009729 (PSMD7)
05012 Parkinson disease
121009729 (PSMD7)
05014 Amyotrophic lateral sclerosis
121009729 (PSMD7)
05016 Huntington disease
121009729 (PSMD7)
05017 Spinocerebellar ataxia
121009729 (PSMD7)
05020 Prion disease
121009729 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
121009729 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
pyu03051
]
121009729 (PSMD7)
Proteasome [BR:
pyu03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
121009729 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Coilin_N
Motif
Other DBs
NCBI-GeneID:
121009729
NCBI-ProteinID:
XP_040298899
LinkDB
All DBs
Position
Unknown
AA seq
324 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KDDKEKEKEKEKSDGKKEEKKEKK
NT seq
975 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggctgtgcagaaggtggtagttcaccccttggtgctgctcagtgtggtg
gatcatttcaaccgaataggcaaggttggaaaccagaagcgtgtcgttggtgtgcttttg
gggtcatggcaaaagaaagtacttgatgtatccaacagttttgcagtaccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaggtcaatgccagagaaagaatcgttgggtggtaccacacaggtcctaaa
ctacacaagaatgacatcgccattaatgaacttatgaagagatactgccctaactcagta
ctggtcattattgacgtgaagccaaaggacctgggactgcccacagaagcatatatttca
gtggaagaagttcacgatgatggaactccaacctcaaaaacatttgagcacgtgaccagt
gaaattggagcagaggaagctgaggaagtcggagtggagcacttgttacgagacatcaaa
gacactacagtgggcactctttcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacctggagaaagtggccacgggcaagctg
cccatcaaccaccagatcatctaccagctacaggacgtcttcaacctgctgccggatgtc
agcctccaggagtttgtcaaggccttttacctgaagaccaacgaccagatggtagtggtg
tatttggcctcgttgatccgttctgtggttgccctgcacaacctcatcaacaacaaaatt
gccaaccgggatgcagagaagaaagaagggcaggaaaaagaagaaagcaaaaaggatagg
aaagatgacaaagagaaagaaaaagagaaggaaaagagtgacggaaagaaagaagagaaa
aaggagaaaaaataa
DBGET
integrated database retrieval system