Puma yagouaroundi (jaguarundi): 121010680 Help Entry 121010680         CDS       T07555                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04630   JAK-STAT signaling pathway pyu04640   Hematopoietic cell lineage pyu04657   IL-17 signaling pathway pyu04658   Th1 and Th2 cell differentiation pyu04660   T cell receptor signaling pathway pyu04664   Fc epsilon RI signaling pathway pyu04672   Intestinal immune network for IgA production pyu05200   Pathways in cancer pyu05310   Asthma pyu05320   Autoimmune thyroid disease pyu05321   Inflammatory bowel disease pyu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121010680 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121010680 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     121010680 (IL5)    04660 T cell receptor signaling pathway     121010680 (IL5)    04658 Th1 and Th2 cell differentiation     121010680 (IL5)    04657 IL-17 signaling pathway     121010680 (IL5)    04664 Fc epsilon RI signaling pathway     121010680 (IL5)    04672 Intestinal immune network for IgA production     121010680 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121010680 (IL5)   09163 Immune disease    05310 Asthma     121010680 (IL5)    05320 Autoimmune thyroid disease     121010680 (IL5)    05321 Inflammatory bowel disease     121010680 (IL5)    05330 Allograft rejection     121010680 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121010680 (IL5)    00536 Glycosaminoglycan binding proteins [BR:pyu00536]     121010680 (IL5) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Interleukins    121010680 (IL5) Glycosaminoglycan binding proteins [BR:pyu00536]  Heparan sulfate / Heparin   Cytokines    121010680 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  121010680 NCBI-ProteinID:  XP_040300365 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSAIAVQSPMNRLVAETLALLSTHRTLLIGDGNLMIPTPEHNNH QLCIEEVFQGIDTLKNHTVPGDAVEKLFRNLSLIKEHIDRQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgccatt gctgtacaaagtcccatgaataggctggtggcagagaccttggcactgctctccactcat cgaactctactgataggcgacgggaacctgatgattcctactcctgaacataacaatcac caactgtgcattgaagaagtcttccagggtatagacacattaaagaatcacactgtaccg ggggatgctgtggaaaagcttttccgaaacttgtctttaataaaagaacacatagaccgc caaaaaaaaaagtgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtaataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system