Herpailurus yagouaroundi (jaguarundi): 121011744 Help Entry 121011744         CDS       T07555                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu04015   Rap1 signaling pathway pyu04810   Regulation of actin cytoskeleton pyu05014   Amyotrophic lateral sclerosis pyu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     121011744 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121011744 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121011744 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121011744 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pyu04131]     121011744 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pyu04812]     121011744 (PFN3)    04147 Exosome [BR:pyu04147]     121011744 (PFN3) Membrane trafficking [BR:pyu04131]  Others   Actin-binding proteins    Others     121011744 (PFN3) Cytoskeleton proteins [BR:pyu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      121011744 (PFN3) Exosome [BR:pyu04147]  Exosomal proteins   Proteins found in most exosomes    121011744 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  121011744 NCBI-ProteinID:  XP_040302321 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIMGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKTVHELINGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggggactggaaaggctatatcagtgcagtgctgcgggaccagcgtattgatgacgtg gccatcatgggccactcagacaatcgctgcgtgtgggcatcgcgccctgggggccttcta gctgccatatcaccgcaggaggtgggtgtgctcacagggcctgatcggcacaccttcctg caggccggcctgagtgtggcaggccgccgctgctgcgtcatccgagaccacctgctgtct gagggagatggtgttctggacgctcgcactaaagggctggatgggcgtgctgtctgcgtg ggccacaccccgcgcgcgctcctggtgctcatgggccgacggggtgtgcatgggggcatc ctcaacaagacagtgcatgagctgatcaatgggctacgcaagcagggcacatag

DBGET integrated database retrieval system