Puma yagouaroundi (jaguarundi): 121012341 Help Entry 121012341         CDS       T07555                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu01521   EGFR tyrosine kinase inhibitor resistance pyu01524   Platinum drug resistance pyu04014   Ras signaling pathway pyu04064   NF-kappa B signaling pathway pyu04115   p53 signaling pathway pyu04137   Mitophagy - animal pyu04140   Autophagy - animal pyu04151   PI3K-Akt signaling pathway pyu04210   Apoptosis pyu04215   Apoptosis - multiple species pyu04621   NOD-like receptor signaling pathway pyu04630   JAK-STAT signaling pathway pyu05012   Parkinson disease pyu05014   Amyotrophic lateral sclerosis pyu05022   Pathways of neurodegeneration - multiple diseases pyu05145   Toxoplasmosis pyu05162   Measles pyu05166   Human T-cell leukemia virus 1 infection pyu05168   Herpes simplex virus 1 infection pyu05170   Human immunodeficiency virus 1 infection pyu05200   Pathways in cancer pyu05202   Transcriptional misregulation in cancer pyu05212   Pancreatic cancer pyu05220   Chronic myeloid leukemia pyu05222   Small cell lung cancer pyu05225   Hepatocellular carcinoma pyu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121012341 (BCL2L1)    04630 JAK-STAT signaling pathway     121012341 (BCL2L1)    04064 NF-kappa B signaling pathway     121012341 (BCL2L1)    04151 PI3K-Akt signaling pathway     121012341 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121012341 (BCL2L1)    04137 Mitophagy - animal     121012341 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     121012341 (BCL2L1)    04215 Apoptosis - multiple species     121012341 (BCL2L1)    04115 p53 signaling pathway     121012341 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121012341 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121012341 (BCL2L1)    05202 Transcriptional misregulation in cancer     121012341 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     121012341 (BCL2L1)    05225 Hepatocellular carcinoma     121012341 (BCL2L1)    05220 Chronic myeloid leukemia     121012341 (BCL2L1)    05222 Small cell lung cancer     121012341 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121012341 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     121012341 (BCL2L1)    05162 Measles     121012341 (BCL2L1)    05168 Herpes simplex virus 1 infection     121012341 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     121012341 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     121012341 (BCL2L1)    05014 Amyotrophic lateral sclerosis     121012341 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     121012341 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121012341 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     121012341 (BCL2L1)    01524 Platinum drug resistance     121012341 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pyu01009]     121012341 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pyu03036]     121012341 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pyu02000]     121012341 (BCL2L1) Protein phosphatases and associated proteins [BR:pyu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      121012341 (BCL2L1) Chromosome and associated proteins [BR:pyu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     121012341 (BCL2L1) Transporters [BR:pyu02000]  Other transporters   Pores ion channels [TC:1]    121012341 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  121012341 NCBI-ProteinID:  XP_040303331 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaagtg atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgtgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system