Puma yagouaroundi (jaguarundi): 121013948 Help Entry 121013948         CDS       T07555                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pyu  Puma yagouaroundi (jaguarundi) Brite KEGG Orthology (KO) [BR:pyu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pyu03041]     121013948 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121013948 (UBL5) Spliceosome [BR:pyu03041]  Complex B   Other components    Complex B specific factors     121013948 (UBL5) Cytokines and neuropeptides [BR:pyu04052]  Neuropeptides   Unclassified    121013948 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  121013948 NCBI-ProteinID:  XP_040305760 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctagggaagaaggtccgcgttaagtgcaacact gatgacaccatcggggaccttaagaagctaatcgcagcccaaactggcacccgttggaac aagatcgtcctgaagaagtggtacacgatttttaaggaccatgtgtctctgggggactat gaaatccacgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system