Puma yagouaroundi (jaguarundi): 121014280 Help Entry 121014280         CDS       T07555                                  Symbol PRLH Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04080   Neuroactive ligand-receptor interaction pyu04081   Hormone signaling Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     121014280 (PRLH)    04081 Hormone signaling     121014280 (PRLH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121014280 (PRLH) Cytokines and neuropeptides [BR:pyu04052]  Neuropeptides   GPCR binding    121014280 (PRLH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prolactin_RP Motif Other DBs NCBI-GeneID:  121014280 NCBI-ProteinID:  XP_040306291 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MKALQAWLLGLLLLGMALWGAASQTHPHSMEIRNPDIDPAWYAGRRIRPVGRFGRRTAAP PGCREPARLLPPERRR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaaggctttgcaggcctggctgctgggcctgctgctgctgggaatggccctgtggggg gctgcgagccaaacccacccacactccatggagatccgcaaccctgacatcgatcctgcc tggtacgcgggccgcaggatcagacccgtgggccgcttcggccggaggacagcagctccc ccgggatgtcgtgaaccggccaggctgctcccccctgaaaggaggcgctga

DBGET integrated database retrieval system