Puma yagouaroundi (jaguarundi): 121014870 Help Entry 121014870         CDS       T07555                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04014   Ras signaling pathway pyu04015   Rap1 signaling pathway pyu04020   Calcium signaling pathway pyu04022   cGMP-PKG signaling pathway pyu04024   cAMP signaling pathway pyu04070   Phosphatidylinositol signaling system pyu04114   Oocyte meiosis pyu04218   Cellular senescence pyu04261   Adrenergic signaling in cardiomyocytes pyu04270   Vascular smooth muscle contraction pyu04371   Apelin signaling pathway pyu04625   C-type lectin receptor signaling pathway pyu04713   Circadian entrainment pyu04720   Long-term potentiation pyu04722   Neurotrophin signaling pathway pyu04728   Dopaminergic synapse pyu04740   Olfactory transduction pyu04744   Phototransduction pyu04750   Inflammatory mediator regulation of TRP channels pyu04910   Insulin signaling pathway pyu04912   GnRH signaling pathway pyu04915   Estrogen signaling pathway pyu04916   Melanogenesis pyu04921   Oxytocin signaling pathway pyu04922   Glucagon signaling pathway pyu04924   Renin secretion pyu04925   Aldosterone synthesis and secretion pyu04970   Salivary secretion pyu04971   Gastric acid secretion pyu05010   Alzheimer disease pyu05012   Parkinson disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05031   Amphetamine addiction pyu05034   Alcoholism pyu05133   Pertussis pyu05152   Tuberculosis pyu05163   Human cytomegalovirus infection pyu05167   Kaposi sarcoma-associated herpesvirus infection pyu05170   Human immunodeficiency virus 1 infection pyu05200   Pathways in cancer pyu05214   Glioma pyu05417   Lipid and atherosclerosis pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121014870    04015 Rap1 signaling pathway     121014870    04371 Apelin signaling pathway     121014870    04020 Calcium signaling pathway     121014870    04070 Phosphatidylinositol signaling system     121014870    04024 cAMP signaling pathway     121014870    04022 cGMP-PKG signaling pathway     121014870  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     121014870    04218 Cellular senescence     121014870  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121014870   09152 Endocrine system    04910 Insulin signaling pathway     121014870    04922 Glucagon signaling pathway     121014870    04912 GnRH signaling pathway     121014870    04915 Estrogen signaling pathway     121014870    04921 Oxytocin signaling pathway     121014870    04916 Melanogenesis     121014870    04924 Renin secretion     121014870    04925 Aldosterone synthesis and secretion     121014870   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121014870    04270 Vascular smooth muscle contraction     121014870   09154 Digestive system    04970 Salivary secretion     121014870    04971 Gastric acid secretion     121014870   09156 Nervous system    04728 Dopaminergic synapse     121014870    04720 Long-term potentiation     121014870    04722 Neurotrophin signaling pathway     121014870   09157 Sensory system    04744 Phototransduction     121014870    04740 Olfactory transduction     121014870    04750 Inflammatory mediator regulation of TRP channels     121014870   09159 Environmental adaptation    04713 Circadian entrainment     121014870  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121014870   09162 Cancer: specific types    05214 Glioma     121014870   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121014870    05163 Human cytomegalovirus infection     121014870    05167 Kaposi sarcoma-associated herpesvirus infection     121014870   09171 Infectious disease: bacterial    05133 Pertussis     121014870    05152 Tuberculosis     121014870   09164 Neurodegenerative disease    05010 Alzheimer disease     121014870    05012 Parkinson disease     121014870    05022 Pathways of neurodegeneration - multiple diseases     121014870   09165 Substance dependence    05031 Amphetamine addiction     121014870    05034 Alcoholism     121014870   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121014870    05418 Fluid shear stress and atherosclerosis     121014870  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pyu01009]     121014870   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pyu04131]     121014870    03036 Chromosome and associated proteins [BR:pyu03036]     121014870   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyu04147]     121014870 Protein phosphatases and associated proteins [BR:pyu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121014870 Membrane trafficking [BR:pyu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121014870 Chromosome and associated proteins [BR:pyu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121014870 Exosome [BR:pyu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121014870 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EH Dockerin_1 EF_EFCAB10_C Temptin_C EFhand_Ca_insen EF-hand_11 Caleosin DUF5580_M SurA_N_3 SurA_N_2 Motif Other DBs NCBI-GeneID:  121014870 NCBI-ProteinID:  XP_040307472 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQVAEFREAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLRGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDD EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgacagaggaacaggtggccgagttcagggaggccttctgcctgttc gacaaggacggggacggcgccatcaccacccaggagctgggcaccgtcatgcggtccctg ggccagaaccccacggaggccgagctgcgggacatggtgggtgagatcgaccgtgacggc aacggctccgtggacttccctgagttcctgggcatgatggcccggcagctgaggggccgg gacagcgaggagcagatccgggaggctttccgcgtgttcgacaaggacggcaacggcctg gtgagcgcggccgagctgcggcacgtgatgaccaggctcggggagaagctgagcgacgac gaggtggacgagatgatccgggccgccgacgtggatggggacggccaggtcaactacgag gagttcgtgcacatgctggtctccaagtga

DBGET integrated database retrieval system