Puma yagouaroundi (jaguarundi): 121017093 Help Entry 121017093         CDS       T07555                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04062   Chemokine signaling pathway pyu04620   Toll-like receptor signaling pathway pyu05142   Chagas disease pyu05163   Human cytomegalovirus infection pyu05323   Rheumatoid arthritis pyu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121017093    04061 Viral protein interaction with cytokine and cytokine receptor     121017093  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121017093    04062 Chemokine signaling pathway     121017093  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     121017093   09174 Infectious disease: parasitic    05142 Chagas disease     121017093   09163 Immune disease    05323 Rheumatoid arthritis     121017093   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121017093  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121017093    00536 Glycosaminoglycan binding proteins [BR:pyu00536]     121017093 Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Chemokines    121017093 Glycosaminoglycan binding proteins [BR:pyu00536]  Heparan sulfate / Heparin   Chemokines    121017093 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  121017093 NCBI-ProteinID:  XP_040311108 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MKVPGAALAILLCTMALCSQVFSAPFGADTPTACCFSYVSKQIPRKFIADYFETSSQCSK PGVIFQTRRGRQVCADPSEAWVQEYVTDLELSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtccccggggctgccctcgccatcctcctctgcaccatggccctctgcagtcag gtcttctctgcaccatttggtgctgacaccccaactgcctgctgcttctcctatgtctcc aagcagattccacgcaagttcatagccgactattttgagaccagcagccaatgctccaag ccaggggttatctttcaaaccagaagaggccggcaggtctgtgctgaccccagtgaagcc tgggtccaggaatatgtgactgacttggagctgagtgcctga

DBGET integrated database retrieval system