Puma yagouaroundi (jaguarundi): 121017096 Help Entry 121017096         CDS       T07555                                  Name (RefSeq) C-C motif chemokine 23-like   KO K05511   C-C motif chemokine 15/23 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121017096    04061 Viral protein interaction with cytokine and cytokine receptor     121017096  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     121017096  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121017096 Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Chemokines    121017096 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  121017096 NCBI-ProteinID:  XP_040311110 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MKVFAAALPFLIVATAFGAQVRALHEPVVAIRPHETSIHLQGFHRPSDCCTQYTPRKIRC GFMEDYYETSSGCSQPGVIFLTKKGQRVCANPFDLGVQNCVRSLKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcttcgcagctgccctccccttcctcattgttgctactgcctttggagcccag gtccgggcccttcatgaacccgtggtggcaatacgtccgcatgaaacctcgatacatctg caaggctttcaccgtccctctgactgctgcacccagtacactccacggaaaatccgatgt ggattcatggaagattactatgaaacaagcagcgggtgctcccagccaggtgtcatcttc ctcaccaagaaggggcagcgtgtctgtgccaacccctttgatttgggagttcagaattgc gtgaggtccctgaagtcgaactaa

DBGET integrated database retrieval system