Puma yagouaroundi (jaguarundi): 121017100 Help Entry 121017100         CDS       T07555                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04062   Chemokine signaling pathway pyu04620   Toll-like receptor signaling pathway pyu04621   NOD-like receptor signaling pathway pyu04623   Cytosolic DNA-sensing pathway pyu04668   TNF signaling pathway pyu05020   Prion disease pyu05142   Chagas disease pyu05163   Human cytomegalovirus infection pyu05164   Influenza A pyu05168   Herpes simplex virus 1 infection pyu05323   Rheumatoid arthritis pyu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     121017100 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121017100 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     121017100 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121017100 (CCL5)    04621 NOD-like receptor signaling pathway     121017100 (CCL5)    04623 Cytosolic DNA-sensing pathway     121017100 (CCL5)    04062 Chemokine signaling pathway     121017100 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     121017100 (CCL5)    05168 Herpes simplex virus 1 infection     121017100 (CCL5)    05163 Human cytomegalovirus infection     121017100 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     121017100 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     121017100 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     121017100 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121017100 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121017100 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:pyu00536]     121017100 (CCL5) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Chemokines    121017100 (CCL5) Glycosaminoglycan binding proteins [BR:pyu00536]  Heparan sulfate / Heparin   Chemokines    121017100 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  121017100 NCBI-ProteinID:  XP_040311114 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MKVSTAAFAVLLTAAFCAPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMPA VVFVTRRKRQVCANPQKKWVRDYINSLEMN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccacagctgcctttgcagtcctcctcactgccgctttctgcgctcctgct tctgcatccccatatgcctcggacaccaccccctgctgctttgcctacctctcccaccca ctgccgctcacccacctccaggagtatttctacaccagcagcaagtgttccatgccagca gtcgtctttgtcacccggaggaagcgccaggtgtgtgccaacccacagaagaaatgggtg cgggactacatcaactctttggagatgaactag

DBGET integrated database retrieval system