Puma yagouaroundi (jaguarundi): 121017127 Help Entry 121017127         CDS       T07555                                  Symbol CCL8 Name (RefSeq) C-C motif chemokine 8   KO K16596   C-C motif chemokine 8 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121017127 (CCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     121017127 (CCL8)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     121017127 (CCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121017127 (CCL8) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Chemokines    121017127 (CCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 DUF3852 Motif Other DBs NCBI-GeneID:  121017127 NCBI-ProteinID:  XP_040311157 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKVSAVLLCLLLTVATFSIRVLAQPGSVSIPITCCFSVVKGKIPMQKLESYTRITNIQCP QEAVIFKTKTSREICADPKQKWVQDFMKRLDQKSQTQKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagtgcttctgtgcctgctgctcacagtggccaccttcagcatccgg gtgcttgctcagccaggttcagtttccatcccaattacctgctgcttcagtgtggtcaaa gggaagatccctatgcagaagctagagagctacacaaggatcaccaacatccagtgtccc caggaagctgtgatcttcaagaccaaaacatccagagagatctgtgctgaccccaagcag aagtgggtccaggatttcatgaagcgcctggaccaaaagtcccaaacccagaaaccttga

DBGET integrated database retrieval system