Puma yagouaroundi (jaguarundi): 121017130 Help Entry 121017130         CDS       T07555                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04062   Chemokine signaling pathway pyu04621   NOD-like receptor signaling pathway pyu04657   IL-17 signaling pathway pyu04668   TNF signaling pathway pyu04933   AGE-RAGE signaling pathway in diabetic complications pyu05135   Yersinia infection pyu05142   Chagas disease pyu05144   Malaria pyu05163   Human cytomegalovirus infection pyu05164   Influenza A pyu05168   Herpes simplex virus 1 infection pyu05171   Coronavirus disease - COVID-19 pyu05323   Rheumatoid arthritis pyu05417   Lipid and atherosclerosis pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     121017130   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121017130    04061 Viral protein interaction with cytokine and cytokine receptor     121017130  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121017130    04657 IL-17 signaling pathway     121017130    04062 Chemokine signaling pathway     121017130  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     121017130    05164 Influenza A     121017130    05168 Herpes simplex virus 1 infection     121017130    05163 Human cytomegalovirus infection     121017130   09171 Infectious disease: bacterial    05135 Yersinia infection     121017130   09174 Infectious disease: parasitic    05144 Malaria     121017130    05142 Chagas disease     121017130   09163 Immune disease    05323 Rheumatoid arthritis     121017130   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121017130    05418 Fluid shear stress and atherosclerosis     121017130   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     121017130  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121017130    00536 Glycosaminoglycan binding proteins [BR:pyu00536]     121017130 Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Chemokines    121017130 Glycosaminoglycan binding proteins [BR:pyu00536]  Heparan sulfate / Heparin   Chemokines    121017130 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  121017130 NCBI-ProteinID:  XP_040311159 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKVSAALLCLLLTAAAFSLQVLAQPDAINSPVTCCYTLTNKKISMQRLVSYKRVTSSKCP KEAVIFKTILNKEICADPKQKWVKDSMAHLDKKTQTAKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagcgcttctgtgcctgctgctcacagctgctgccttcagcctccag gtgctcgcccagccagatgcaattaattctccagtcacctgctgctatacactcaccaat aagaagatctcgatgcagaggctggtgagctataaaagagtcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccatcctaaacaaggagatctgcgctgacccaaagcag aagtgggtcaaggattccatggcacacctggacaagaagacccaaactgcaaagccttga

DBGET integrated database retrieval system