Puma yagouaroundi (jaguarundi): 121017375 Help Entry 121017375         CDS       T07555                                  Symbol CCL1 Name (RefSeq) C-C motif chemokine 1   KO K05514   C-C motif chemokine 1 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121017375 (CCL1)    04061 Viral protein interaction with cytokine and cytokine receptor     121017375 (CCL1)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     121017375 (CCL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121017375 (CCL1) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Chemokines    121017375 (CCL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  121017375 NCBI-ProteinID:  XP_040311545 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MKLITVALVCLLLAGMWLREADSRSMHVSSSNCCFTFVEKKISSQRIQCYKNTSSACSRS SLIIKLKGGRETCVLPTAGWVKQSLKSKKPCLLK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaagctcatcaccgtggccctggtgtgcctgctgctggctgggatgtggctgcgcgag gcggacagcaggagcatgcacgtatcgtcctccaactgttgcttcacgtttgtggagaag aagatttcctcgcagagaatccagtgttacaaaaacaccagctccgcgtgctcccgcagt agtctaataatcaagctgaagggaggcagagagacctgtgtcttgccgacagccggatgg gttaagcaatctttaaagtccaagaaaccgtgcctgctaaagtaa

DBGET integrated database retrieval system