Puma yagouaroundi (jaguarundi): 121017376 Help Entry 121017376         CDS       T07555                                  Name (RefSeq) C-C motif chemokine 13-like   KO K16595   C-C motif chemokine 13 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04062   Chemokine signaling pathway pyu04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     121017376   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121017376    04061 Viral protein interaction with cytokine and cytokine receptor     121017376  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     121017376  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121017376    00536 Glycosaminoglycan binding proteins [BR:pyu00536]     121017376 Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Chemokines    121017376 Glycosaminoglycan binding proteins [BR:pyu00536]  Heparan sulfate / Heparin   Chemokines    121017376 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  121017376 NCBI-ProteinID:  XP_040311546 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MRVSAALLCLLLAAAAFSLQALAQPGAFSALFPCCFTFNNKKIPLPKLTTYRITSSHCPQ TAVIFRTKLAKEICADPKEKWVQEYVKQLSQKSRALKP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagggtctccgcagcgcttctgtgcctgctgctggcagctgccgccttcagcctccag gcgctcgcccagccaggtgcattcagtgccctgttcccttgctgtttcacgtttaacaat aagaagatccccttgccgaagctgacgacctatcgaatcaccagcagccactgtccccag acagctgtcatcttcaggacgaagctggccaaggagatctgtgctgacccgaaggagaaa tgggtccaggagtatgtgaaacagctcagtcaaaaatctcgtgccctgaagccttga

DBGET integrated database retrieval system