Puma yagouaroundi (jaguarundi): 121017928 Help Entry 121017928         CDS       T07555                                  Symbol GSTM4 Name (RefSeq) glutathione S-transferase Mu 4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu00480   Glutathione metabolism pyu00980   Metabolism of xenobiotics by cytochrome P450 pyu00982   Drug metabolism - cytochrome P450 pyu00983   Drug metabolism - other enzymes pyu01100   Metabolic pathways pyu01524   Platinum drug resistance pyu05200   Pathways in cancer pyu05204   Chemical carcinogenesis - DNA adducts pyu05207   Chemical carcinogenesis - receptor activation pyu05208   Chemical carcinogenesis - reactive oxygen species pyu05225   Hepatocellular carcinoma pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     121017928 (GSTM4)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     121017928 (GSTM4)    00982 Drug metabolism - cytochrome P450     121017928 (GSTM4)    00983 Drug metabolism - other enzymes     121017928 (GSTM4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121017928 (GSTM4)    05204 Chemical carcinogenesis - DNA adducts     121017928 (GSTM4)    05207 Chemical carcinogenesis - receptor activation     121017928 (GSTM4)    05208 Chemical carcinogenesis - reactive oxygen species     121017928 (GSTM4)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     121017928 (GSTM4)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121017928 (GSTM4)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     121017928 (GSTM4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pyu02000]     121017928 (GSTM4) Enzymes [BR:pyu01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      121017928 (GSTM4) Transporters [BR:pyu02000]  Other transporters   Pores ion channels [TC:1]    121017928 (GSTM4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_C_6 Motif Other DBs NCBI-GeneID:  121017928 NCBI-ProteinID:  XP_040312373 LinkDB All DBs Position Unknown AA seq 232 aa AA seqDB search MILGYWDIHYLQQRKAGCQDFSDVFLGFPSQRAHAIHLLLAYIDSHYEGKKYTMGDAPDY DRSQWLDEKFKLGLDFPNLPYLIDGAHKIILCYIARKHNLCGETEEEVIHVDLLENQAMD ASNQLTRVCYSPDFERLKPAYLESIPGEMKLYSQFLGKRPWFAGEKITCLDFLAYDILDL HCIFEPKSLDAFPNLKEFVARFEGLKKISAYMKSSRFLPGPLFLKIAFWGNK NT seq 699 nt NT seq  +upstreamnt  +downstreamnt atgatcttaggttactgggacatccattatctgcagcagagaaaagcaggatgtcaggac ttctctgatgtcttcctcgggtttccctcccagcgggctcacgccatccacctgctcctg gcctacatagactcacactatgagggaaagaagtacacgatgggggatgctccggactat gacagaagccagtggctggatgaaaaattcaagctgggcctggactttcccaatctgccc tacttaattgatggggctcacaagatcatcctttgctacattgcccgcaaacacaacctg tgtggggagacagaagaggaggtgattcatgtggatcttttggagaaccaagctatggac gcctctaatcagctcaccagggtctgctacagccctgactttgagagactgaagcctgcg tatctggagtccatcccaggcgagatgaagctatactcacagtttctggggaagaggcct tggtttgcaggggagaagatcacctgtttggatttcctggcttatgacatccttgacctg cactgcatatttgagcccaagtctctggacgcattccccaacctgaaagagtttgtggcc cgctttgagggcctgaagaagatctctgcctacatgaagtccagccgcttcctcccaggc cctctgtttctaaagatcgccttttggggcaacaagtag

DBGET integrated database retrieval system