Herpailurus yagouaroundi (jaguarundi): 121019338 Help Entry 121019338         CDS       T07555                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu04014   Ras signaling pathway pyu04015   Rap1 signaling pathway pyu04020   Calcium signaling pathway pyu04022   cGMP-PKG signaling pathway pyu04024   cAMP signaling pathway pyu04070   Phosphatidylinositol signaling system pyu04114   Oocyte meiosis pyu04218   Cellular senescence pyu04261   Adrenergic signaling in cardiomyocytes pyu04270   Vascular smooth muscle contraction pyu04371   Apelin signaling pathway pyu04625   C-type lectin receptor signaling pathway pyu04713   Circadian entrainment pyu04720   Long-term potentiation pyu04722   Neurotrophin signaling pathway pyu04728   Dopaminergic synapse pyu04740   Olfactory transduction pyu04744   Phototransduction pyu04750   Inflammatory mediator regulation of TRP channels pyu04910   Insulin signaling pathway pyu04912   GnRH signaling pathway pyu04915   Estrogen signaling pathway pyu04916   Melanogenesis pyu04921   Oxytocin signaling pathway pyu04922   Glucagon signaling pathway pyu04924   Renin secretion pyu04925   Aldosterone synthesis and secretion pyu04970   Salivary secretion pyu04971   Gastric acid secretion pyu05010   Alzheimer disease pyu05012   Parkinson disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05031   Amphetamine addiction pyu05034   Alcoholism pyu05133   Pertussis pyu05152   Tuberculosis pyu05163   Human cytomegalovirus infection pyu05167   Kaposi sarcoma-associated herpesvirus infection pyu05170   Human immunodeficiency virus 1 infection pyu05200   Pathways in cancer pyu05214   Glioma pyu05417   Lipid and atherosclerosis pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121019338 (CALML6)    04015 Rap1 signaling pathway     121019338 (CALML6)    04371 Apelin signaling pathway     121019338 (CALML6)    04020 Calcium signaling pathway     121019338 (CALML6)    04070 Phosphatidylinositol signaling system     121019338 (CALML6)    04024 cAMP signaling pathway     121019338 (CALML6)    04022 cGMP-PKG signaling pathway     121019338 (CALML6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     121019338 (CALML6)    04218 Cellular senescence     121019338 (CALML6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121019338 (CALML6)   09152 Endocrine system    04910 Insulin signaling pathway     121019338 (CALML6)    04922 Glucagon signaling pathway     121019338 (CALML6)    04912 GnRH signaling pathway     121019338 (CALML6)    04915 Estrogen signaling pathway     121019338 (CALML6)    04921 Oxytocin signaling pathway     121019338 (CALML6)    04916 Melanogenesis     121019338 (CALML6)    04924 Renin secretion     121019338 (CALML6)    04925 Aldosterone synthesis and secretion     121019338 (CALML6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121019338 (CALML6)    04270 Vascular smooth muscle contraction     121019338 (CALML6)   09154 Digestive system    04970 Salivary secretion     121019338 (CALML6)    04971 Gastric acid secretion     121019338 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     121019338 (CALML6)    04720 Long-term potentiation     121019338 (CALML6)    04722 Neurotrophin signaling pathway     121019338 (CALML6)   09157 Sensory system    04744 Phototransduction     121019338 (CALML6)    04740 Olfactory transduction     121019338 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     121019338 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     121019338 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121019338 (CALML6)   09162 Cancer: specific types    05214 Glioma     121019338 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121019338 (CALML6)    05163 Human cytomegalovirus infection     121019338 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     121019338 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     121019338 (CALML6)    05152 Tuberculosis     121019338 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     121019338 (CALML6)    05012 Parkinson disease     121019338 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     121019338 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     121019338 (CALML6)    05034 Alcoholism     121019338 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121019338 (CALML6)    05418 Fluid shear stress and atherosclerosis     121019338 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pyu01009]     121019338 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pyu04131]     121019338 (CALML6)    03036 Chromosome and associated proteins [BR:pyu03036]     121019338 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyu04147]     121019338 (CALML6) Protein phosphatases and associated proteins [BR:pyu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121019338 (CALML6) Membrane trafficking [BR:pyu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121019338 (CALML6) Chromosome and associated proteins [BR:pyu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121019338 (CALML6) Exosome [BR:pyu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121019338 (CALML6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EF_EFCAB10_C EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  121019338 NCBI-ProteinID:  XP_040314627 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MTERLTAEQIKEYKGVFEMFDEEGNGEVKTAELERLMSLLGINPTKSELASMAKDVDRDN KGFFNCDSFLALMGIYWEKAQNQEGELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNE VEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLVQ NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgacggagcgcctgacggccgagcagatcaaggagtacaagggggtctttgagatgttc gacgaggagggcaacggggaggtgaagacggcggagctggaacggctcatgagcctgctg ggcatcaaccccaccaagagcgagctggcttccatggccaaggacgtggacagagacaac aaaggattcttcaactgtgacagcttcctggccctgatggggatttactgggagaaggcc cagaaccaggagggcgagctgagggcagccttccgtgtcttcgacaaggagggcaagggc tacatcgactggaacacgcttaagtacgtgctcatgaatgcaggtgagcccctcaatgag gtagaggccgagcagatgatgaaggaggctgacaaggacggagacggaaccattgactat gaggagtttgtggccatgatgaccggagagtccttcaagctggtccagtag

DBGET integrated database retrieval system