Puma yagouaroundi (jaguarundi): 121021881 Help Entry 121021881         CDS       T07555                                  Symbol FGF22 Name (RefSeq) fibroblast growth factor 22   KO K04358   fibroblast growth factor Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04010   MAPK signaling pathway pyu04014   Ras signaling pathway pyu04015   Rap1 signaling pathway pyu04020   Calcium signaling pathway pyu04151   PI3K-Akt signaling pathway pyu04810   Regulation of actin cytoskeleton pyu05200   Pathways in cancer pyu05207   Chemical carcinogenesis - receptor activation pyu05218   Melanoma pyu05224   Breast cancer pyu05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121021881 (FGF22)    04014 Ras signaling pathway     121021881 (FGF22)    04015 Rap1 signaling pathway     121021881 (FGF22)    04020 Calcium signaling pathway     121021881 (FGF22)    04151 PI3K-Akt signaling pathway     121021881 (FGF22)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121021881 (FGF22)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121021881 (FGF22)    05207 Chemical carcinogenesis - receptor activation     121021881 (FGF22)   09162 Cancer: specific types    05226 Gastric cancer     121021881 (FGF22)    05218 Melanoma     121021881 (FGF22)    05224 Breast cancer     121021881 (FGF22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121021881 (FGF22)    00536 Glycosaminoglycan binding proteins [BR:pyu00536]     121021881 (FGF22) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Growth factors (RTK binding)    121021881 (FGF22) Glycosaminoglycan binding proteins [BR:pyu00536]  Heparan sulfate / Heparin   Growth factors/receptors    121021881 (FGF22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  121021881 NCBI-ProteinID:  XP_040318494 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MRGRLWLSLVWLLLARASGAAGTPNSPRRPRSYPHLEGDVRWRRLFSSTHFFLRVDPSGR VQGTRWRHGADSIIEIRSIRVGVVALKAVHTGFYVAMNRGGHLYGSRVYTAHCRFQERIE ENGYNTYASLRWRHRGRPMFLALDGQGSPRRGGRTQRHHLSTHFLPVLVS NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgcgcggccgcctgtggctgagcctggtgtggctgctgctggcgcgggcgtccggcgcc gcggggaccccaaacagcccgcggagaccgcgcagctacccgcacctggagggcgacgtg cgctggaggcgcctcttctcctccacccacttcttcctgcgagtggaccccagcggccgc gtgcagggcacccgctggcgtcacggagctgacagcatcattgagatccgctccatccgt gtgggcgtcgtggccctcaaggctgtgcacaccggcttctacgtggccatgaaccgcggg ggccatctctacgggtcgcgggtctacaccgcccactgcaggttccaggagcgcatcgag gagaacggctataacacctacgcctcgctccgctggcgtcaccgcggtcggcccatgttc ctggcgctggatgggcaggggtccccgaggcgcggtggccggacacagcggcaccacctg tccacccacttcctgcccgtcctggtctcctga

DBGET integrated database retrieval system