KEGG   Puma yagouaroundi (jaguarundi): 121022199
Entry
121022199         CDS       T07555                                 
Name
(RefSeq) integrin alpha-X-like isoform X1
  KO
K06462  integrin alpha X
Organism
pyu  Puma yagouaroundi (jaguarundi)
Pathway
pyu04610  Complement and coagulation cascades
pyu04810  Regulation of actin cytoskeleton
pyu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pyu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    121022199
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    121022199
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    121022199
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pyu04515]
    121022199
   04090 CD molecules [BR:pyu04090]
    121022199
Cell adhesion molecules [BR:pyu04515]
 Integrins
  Integrin alpha subunits
   121022199
CD molecules [BR:pyu04090]
 Proteins
  121022199
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 FG-GAP_2 VWA_CoxE
Other DBs
NCBI-GeneID: 121022199
NCBI-ProteinID: XP_040319098
LinkDB
Position
Unknown
AA seq 841 aa
MTMIRTFLLLMGLASSLCFNLDTDQPTTFLMESAGFGYSVVQYANSWVVVGAPQEIKAAN
QTGSLYQCDYRTGKCEPIRLKIPPEAVNMSLGLSLAASTNPSQLLACGPTVHHTCKENMY
LTGFCFLLVSPSWQAQRLPAALQECPRQEQDIVFLIDGSGSISFRDFTKMLNFVKAVMSQ
FQRPSTQFSLMQFSHHSWVHFTFKDFIYSSNPLGLLDSVQQLRGFTYTATAIQMVTNQLF
SASSGARKDASKILIVITDGQKQGDPLGYEDVIPRAEAAGIIRYAVGVGLAFQNPHSRKE
LNDIASKPSHEHIFQVENFDALRDIQNQLKEKIFAIEGTQTISSSSFELEMSQEGFSAVF
SPDGPVLGAVGSFSWSGGAFLYPQNMNPTFINMSQENVDMRDSYLGYSTELALWKGVKIL
ILGAPRHQHTGKVVIFTQASGQWRPKAEVAGTQIGSYFGASLCSVDVNRDGNSDLVLIGA
PHYYKPTRGGQVSMCHLPLGRARWQCEVILCGEQGHPWGRFGAALTVLGDVNGDKLTDVA
IGAPGEQENQGAVYLFHGTSELGISPSHSQRISGSQLSPSLQYFGQSLSGGQDLTLDGLV
DLAVGAQGQVMLLRTRPVLRVWMNIQFTSAEIARSVFECREETASVKALGDANVCLRIYE
SPKNQLGDLQSSVTFDLTLDPGRQNPRAIFEETKARNLTHVRVLGLRQYCETVRLLLLAC
VEDSVTPITLRLNFSLVGKPIPSFGNLQPILAVDAQRYFVASLPFEKNCGTDHVCQDDLG
ISFDFSGLKTLVVGSTLELNMKVTVWNDGEDSYGTTITFFYPPGLSYRRVAGSQVSGEES
S
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgaccatgatcaggaccttcctcctgttgatgggcttggcttcttctctctgtttcaac
ttggatacagaccagccaacaaccttccttatggagagtgctgggtttggatacagtgtg
gtccagtatgccaactcctgggtggtggttggagccccccaggagataaaggctgccaac
caaacaggtagcctctaccagtgtgactacagaacgggcaagtgtgagcccatccgcctg
aagatccccccagaagcagtgaacatgtccttgggcctgtccctggcagcctcaaccaac
ccctctcaactgctggcctgtggccccacagtgcaccatacatgcaaggagaacatgtac
ttgactgggttctgtttcctgctggtttccccttcctggcaggcccagaggctcccggct
gccctgcaggagtgtccaaggcaggagcaggatattgtgttcctgatcgatggctcaggc
agcatctccttcagagattttaccaagatgttgaattttgtgaaggccgttatgagccag
ttccagagacctagcacccagttctctctgatgcagttctcccaccattcctgggtgcac
ttcactttcaaagacttcatatacagctcaaacccactaggcctgttggattctgtacaa
cagctgcgagggttcacttacacagctacagccatccaaatggttacaaatcaactgttc
agtgcctcaagtggggcccgaaaagatgcctccaagatccttattgtcatcactgatggt
cagaaacaaggagaccccctgggttatgaggatgttatccctagggctgaagctgccggt
atcattcgctatgcagttggggtgggattggcttttcaaaatccacattcccggaaagaa
ttaaatgacattgcatcgaagccctcccatgagcacatttttcaagtggagaattttgat
gctttgagagacattcaaaaccaactgaaagagaagatctttgccattgagggtacgcag
accataagcagtagttcctttgaattggagatgtcccaggagggtttcagcgctgtgttc
tcacctgacgggccagttctgggggctgtggggagcttcagctggtctggaggagccttc
ctatacccccaaaatatgaaccccactttcatcaacatgtctcaagagaatgtggacatg
agggactcttatctaggttactctactgagctggcactttggaagggggtgaagatcctg
atcctgggggccccccgccatcagcatactgggaaggttgtcatcttcactcaggcatcc
gggcaatggaggccgaaggctgaagttgcagggacccagattggttcctactttggggcc
tccctctgctctgtcgatgtgaacagagatggcaactctgacctcgtcctcattggggct
ccacattactacaagccaacccggggggggcaggtgtccatgtgccacttgcccctgggg
agagctagatggcagtgtgaggtcattctctgtggggagcagggccacccctggggccgc
tttggggcagccttgacagtgctgggtgatgtgaatggggacaagctgacagatgtggcc
attggggccccaggagaacaggagaaccagggtgctgtctacctatttcatggaacctca
gaactgggcatcagcccctcccacagccagcggatctcaggctcccagctttcccccagc
ctccagtattttgggcagtcactgagtgggggtcaggaccttaccctggatggactggtg
gacctggctgtgggggcccaggggcaggtgatgttgctaaggaccagacctgtgctcagg
gtgtggatgaatatccaattcacatctgcagagattgccaggtctgtgtttgaatgtcgg
gaagagacagcctctgtcaaggcactgggtgatgccaacgtctgccttcgtatttatgaa
agtcccaagaatcagctgggtgacctccaaagctctgtgacctttgacctgaccctcgac
cctggccgccagaatccccgtgccatctttgaggagacaaaagcccggaatctgactcat
gtccgagtccttgggctgagacagtactgtgagaccgtgaggttgctcctcctggcctgt
gtggaggactcagtgacccccatcaccttgcgtctcaacttctccctggtgggaaaacct
atcccttcctttggaaacctccagcctatcttggctgtggatgctcagcgatacttcgtg
gcctctcttccctttgagaagaattgtggaactgaccatgtctgtcaggatgaccttggc
atctcctttgacttctcaggcttgaagactctggtggtggggagtaccctggagctgaat
atgaaagtgacagtgtggaatgatggtgaagactcctatggaaccacaatcaccttcttc
taccctccagggctgtcttatcgtcgtgtggcagggagccaggtatctggggaagaaagc
agctga

DBGET integrated database retrieval system