Puma yagouaroundi (jaguarundi): 121022378 Help Entry 121022378         CDS       T07555                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu03008   Ribosome biogenesis in eukaryotes pyu03083   Polycomb repressive complex pyu04064   NF-kappa B signaling pathway pyu04137   Mitophagy - animal pyu04310   Wnt signaling pathway pyu04520   Adherens junction pyu05010   Alzheimer disease pyu05020   Prion disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05162   Measles pyu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:pyu00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     121022378 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     121022378 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     121022378 (CSNK2B)    04064 NF-kappa B signaling pathway     121022378 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     121022378 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     121022378 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121022378 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     121022378 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     121022378 (CSNK2B)    05020 Prion disease     121022378 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     121022378 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:pyu03009]     121022378 (CSNK2B)    03036 Chromosome and associated proteins [BR:pyu03036]     121022378 (CSNK2B) Ribosome biogenesis [BR:pyu03009]  Eukaryotic type   90S particles    Kinase     121022378 (CSNK2B) Chromosome and associated proteins [BR:pyu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      121022378 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  121022378 NCBI-ProteinID:  XP_040319370 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaagtggatgaagactacatccaggacaaattcaacctcactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagcgacctgattgagcaggcagccgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcattgcccagatgttggaaaag taccagcaaggagactttggctactgtccccgtgtgtactgtgagaatcagccaatgctt cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccatcacacggacggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccctgagtaccggcccaaacggcccgcc aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system