KEGG   Herpailurus yagouaroundi (jaguarundi): 121023018
Entry
121023018         CDS       T07555                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pyu  Herpailurus yagouaroundi (jaguarundi)
Pathway
pyu01521  EGFR tyrosine kinase inhibitor resistance
pyu01522  Endocrine resistance
pyu01524  Platinum drug resistance
pyu04010  MAPK signaling pathway
pyu04012  ErbB signaling pathway
pyu04014  Ras signaling pathway
pyu04015  Rap1 signaling pathway
pyu04022  cGMP-PKG signaling pathway
pyu04024  cAMP signaling pathway
pyu04062  Chemokine signaling pathway
pyu04066  HIF-1 signaling pathway
pyu04068  FoxO signaling pathway
pyu04071  Sphingolipid signaling pathway
pyu04072  Phospholipase D signaling pathway
pyu04114  Oocyte meiosis
pyu04140  Autophagy - animal
pyu04148  Efferocytosis
pyu04150  mTOR signaling pathway
pyu04151  PI3K-Akt signaling pathway
pyu04210  Apoptosis
pyu04218  Cellular senescence
pyu04261  Adrenergic signaling in cardiomyocytes
pyu04270  Vascular smooth muscle contraction
pyu04350  TGF-beta signaling pathway
pyu04360  Axon guidance
pyu04370  VEGF signaling pathway
pyu04371  Apelin signaling pathway
pyu04380  Osteoclast differentiation
pyu04510  Focal adhesion
pyu04520  Adherens junction
pyu04540  Gap junction
pyu04550  Signaling pathways regulating pluripotency of stem cells
pyu04611  Platelet activation
pyu04613  Neutrophil extracellular trap formation
pyu04620  Toll-like receptor signaling pathway
pyu04621  NOD-like receptor signaling pathway
pyu04625  C-type lectin receptor signaling pathway
pyu04650  Natural killer cell mediated cytotoxicity
pyu04657  IL-17 signaling pathway
pyu04658  Th1 and Th2 cell differentiation
pyu04659  Th17 cell differentiation
pyu04660  T cell receptor signaling pathway
pyu04662  B cell receptor signaling pathway
pyu04664  Fc epsilon RI signaling pathway
pyu04666  Fc gamma R-mediated phagocytosis
pyu04668  TNF signaling pathway
pyu04713  Circadian entrainment
pyu04720  Long-term potentiation
pyu04722  Neurotrophin signaling pathway
pyu04723  Retrograde endocannabinoid signaling
pyu04724  Glutamatergic synapse
pyu04725  Cholinergic synapse
pyu04726  Serotonergic synapse
pyu04730  Long-term depression
pyu04810  Regulation of actin cytoskeleton
pyu04910  Insulin signaling pathway
pyu04912  GnRH signaling pathway
pyu04914  Progesterone-mediated oocyte maturation
pyu04915  Estrogen signaling pathway
pyu04916  Melanogenesis
pyu04917  Prolactin signaling pathway
pyu04919  Thyroid hormone signaling pathway
pyu04921  Oxytocin signaling pathway
pyu04926  Relaxin signaling pathway
pyu04928  Parathyroid hormone synthesis, secretion and action
pyu04929  GnRH secretion
pyu04930  Type II diabetes mellitus
pyu04933  AGE-RAGE signaling pathway in diabetic complications
pyu04934  Cushing syndrome
pyu04935  Growth hormone synthesis, secretion and action
pyu04960  Aldosterone-regulated sodium reabsorption
pyu05010  Alzheimer disease
pyu05020  Prion disease
pyu05022  Pathways of neurodegeneration - multiple diseases
pyu05034  Alcoholism
pyu05132  Salmonella infection
pyu05133  Pertussis
pyu05135  Yersinia infection
pyu05140  Leishmaniasis
pyu05142  Chagas disease
pyu05145  Toxoplasmosis
pyu05152  Tuberculosis
pyu05160  Hepatitis C
pyu05161  Hepatitis B
pyu05163  Human cytomegalovirus infection
pyu05164  Influenza A
pyu05165  Human papillomavirus infection
pyu05166  Human T-cell leukemia virus 1 infection
pyu05167  Kaposi sarcoma-associated herpesvirus infection
pyu05170  Human immunodeficiency virus 1 infection
pyu05171  Coronavirus disease - COVID-19
pyu05200  Pathways in cancer
pyu05203  Viral carcinogenesis
pyu05205  Proteoglycans in cancer
pyu05206  MicroRNAs in cancer
pyu05207  Chemical carcinogenesis - receptor activation
pyu05208  Chemical carcinogenesis - reactive oxygen species
pyu05210  Colorectal cancer
pyu05211  Renal cell carcinoma
pyu05212  Pancreatic cancer
pyu05213  Endometrial cancer
pyu05214  Glioma
pyu05215  Prostate cancer
pyu05216  Thyroid cancer
pyu05218  Melanoma
pyu05219  Bladder cancer
pyu05220  Chronic myeloid leukemia
pyu05221  Acute myeloid leukemia
pyu05223  Non-small cell lung cancer
pyu05224  Breast cancer
pyu05225  Hepatocellular carcinoma
pyu05226  Gastric cancer
pyu05230  Central carbon metabolism in cancer
pyu05231  Choline metabolism in cancer
pyu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pyu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pyu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    121023018 (MAPK1)
   04012 ErbB signaling pathway
    121023018 (MAPK1)
   04014 Ras signaling pathway
    121023018 (MAPK1)
   04015 Rap1 signaling pathway
    121023018 (MAPK1)
   04350 TGF-beta signaling pathway
    121023018 (MAPK1)
   04370 VEGF signaling pathway
    121023018 (MAPK1)
   04371 Apelin signaling pathway
    121023018 (MAPK1)
   04668 TNF signaling pathway
    121023018 (MAPK1)
   04066 HIF-1 signaling pathway
    121023018 (MAPK1)
   04068 FoxO signaling pathway
    121023018 (MAPK1)
   04072 Phospholipase D signaling pathway
    121023018 (MAPK1)
   04071 Sphingolipid signaling pathway
    121023018 (MAPK1)
   04024 cAMP signaling pathway
    121023018 (MAPK1)
   04022 cGMP-PKG signaling pathway
    121023018 (MAPK1)
   04151 PI3K-Akt signaling pathway
    121023018 (MAPK1)
   04150 mTOR signaling pathway
    121023018 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    121023018 (MAPK1)
   04148 Efferocytosis
    121023018 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    121023018 (MAPK1)
   04210 Apoptosis
    121023018 (MAPK1)
   04218 Cellular senescence
    121023018 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    121023018 (MAPK1)
   04520 Adherens junction
    121023018 (MAPK1)
   04540 Gap junction
    121023018 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    121023018 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    121023018 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    121023018 (MAPK1)
   04613 Neutrophil extracellular trap formation
    121023018 (MAPK1)
   04620 Toll-like receptor signaling pathway
    121023018 (MAPK1)
   04621 NOD-like receptor signaling pathway
    121023018 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    121023018 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    121023018 (MAPK1)
   04660 T cell receptor signaling pathway
    121023018 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    121023018 (MAPK1)
   04659 Th17 cell differentiation
    121023018 (MAPK1)
   04657 IL-17 signaling pathway
    121023018 (MAPK1)
   04662 B cell receptor signaling pathway
    121023018 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    121023018 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    121023018 (MAPK1)
   04062 Chemokine signaling pathway
    121023018 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    121023018 (MAPK1)
   04929 GnRH secretion
    121023018 (MAPK1)
   04912 GnRH signaling pathway
    121023018 (MAPK1)
   04915 Estrogen signaling pathway
    121023018 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    121023018 (MAPK1)
   04917 Prolactin signaling pathway
    121023018 (MAPK1)
   04921 Oxytocin signaling pathway
    121023018 (MAPK1)
   04926 Relaxin signaling pathway
    121023018 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    121023018 (MAPK1)
   04919 Thyroid hormone signaling pathway
    121023018 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    121023018 (MAPK1)
   04916 Melanogenesis
    121023018 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    121023018 (MAPK1)
   04270 Vascular smooth muscle contraction
    121023018 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    121023018 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    121023018 (MAPK1)
   04725 Cholinergic synapse
    121023018 (MAPK1)
   04726 Serotonergic synapse
    121023018 (MAPK1)
   04720 Long-term potentiation
    121023018 (MAPK1)
   04730 Long-term depression
    121023018 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    121023018 (MAPK1)
   04722 Neurotrophin signaling pathway
    121023018 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    121023018 (MAPK1)
   04380 Osteoclast differentiation
    121023018 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    121023018 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    121023018 (MAPK1)
   05206 MicroRNAs in cancer
    121023018 (MAPK1)
   05205 Proteoglycans in cancer
    121023018 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    121023018 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    121023018 (MAPK1)
   05203 Viral carcinogenesis
    121023018 (MAPK1)
   05230 Central carbon metabolism in cancer
    121023018 (MAPK1)
   05231 Choline metabolism in cancer
    121023018 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    121023018 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    121023018 (MAPK1)
   05212 Pancreatic cancer
    121023018 (MAPK1)
   05225 Hepatocellular carcinoma
    121023018 (MAPK1)
   05226 Gastric cancer
    121023018 (MAPK1)
   05214 Glioma
    121023018 (MAPK1)
   05216 Thyroid cancer
    121023018 (MAPK1)
   05221 Acute myeloid leukemia
    121023018 (MAPK1)
   05220 Chronic myeloid leukemia
    121023018 (MAPK1)
   05218 Melanoma
    121023018 (MAPK1)
   05211 Renal cell carcinoma
    121023018 (MAPK1)
   05219 Bladder cancer
    121023018 (MAPK1)
   05215 Prostate cancer
    121023018 (MAPK1)
   05213 Endometrial cancer
    121023018 (MAPK1)
   05224 Breast cancer
    121023018 (MAPK1)
   05223 Non-small cell lung cancer
    121023018 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    121023018 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    121023018 (MAPK1)
   05161 Hepatitis B
    121023018 (MAPK1)
   05160 Hepatitis C
    121023018 (MAPK1)
   05171 Coronavirus disease - COVID-19
    121023018 (MAPK1)
   05164 Influenza A
    121023018 (MAPK1)
   05163 Human cytomegalovirus infection
    121023018 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    121023018 (MAPK1)
   05165 Human papillomavirus infection
    121023018 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    121023018 (MAPK1)
   05135 Yersinia infection
    121023018 (MAPK1)
   05133 Pertussis
    121023018 (MAPK1)
   05152 Tuberculosis
    121023018 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    121023018 (MAPK1)
   05140 Leishmaniasis
    121023018 (MAPK1)
   05142 Chagas disease
    121023018 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    121023018 (MAPK1)
   05020 Prion disease
    121023018 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    121023018 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    121023018 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    121023018 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    121023018 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    121023018 (MAPK1)
   04934 Cushing syndrome
    121023018 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    121023018 (MAPK1)
   01524 Platinum drug resistance
    121023018 (MAPK1)
   01522 Endocrine resistance
    121023018 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pyu01001]
    121023018 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pyu03036]
    121023018 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pyu04147]
    121023018 (MAPK1)
Enzymes [BR:pyu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     121023018 (MAPK1)
Protein kinases [BR:pyu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   121023018 (MAPK1)
Chromosome and associated proteins [BR:pyu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     121023018 (MAPK1)
Exosome [BR:pyu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   121023018 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 121023018
NCBI-ProteinID: XP_040320575
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctttcgtatatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattagagcgccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaatgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcttggcccgcgttgcagatccagaccatgatcac
acagggttcctgacggagtacgtagccacacgttggtaccgggctccagaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaattgtataataaatttaaaagct
agaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgattccaaagctctggatttactggacaaaatgttgacgttcaaccctcacaag
aggattgaagtagaacaggctctggcccatccatatctggagcagtattacgacccaagt
gatgagcccgtcgctgaggcaccgttcaagttcgacatggagctagacgacctgcccaag
gaaaagctcaaagagctcatcttcgaagagacggccaggttccagcccggatacaggtct
taa

DBGET integrated database retrieval system