Puma yagouaroundi (jaguarundi): 121023664 Help Entry 121023664         CDS       T07555                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu03030   DNA replication pyu03410   Base excision repair pyu03420   Nucleotide excision repair pyu03430   Mismatch repair pyu03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pyu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     121023664 (POLD4)    03410 Base excision repair     121023664 (POLD4)    03420 Nucleotide excision repair     121023664 (POLD4)    03430 Mismatch repair     121023664 (POLD4)    03440 Homologous recombination     121023664 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pyu03032]     121023664 (POLD4)    03400 DNA repair and recombination proteins [BR:pyu03400]     121023664 (POLD4) DNA replication proteins [BR:pyu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     121023664 (POLD4) DNA repair and recombination proteins [BR:pyu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       121023664 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      121023664 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 Motif Other DBs NCBI-GeneID:  121023664 NCBI-ProteinID:  XP_040321571 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPLSVDEAELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLEPPAEVRQVLQTHPGDPRFQYSLWHVYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaagcggctcatcactgactcctaccctgtagtgaagaggagggagggcccc gctgggcacagcaagggggagctggcgccagagctaggggaagagccccagcctctgagc gtggatgaagcagagctggagctgctgaggcagtttgatctggcctggcaatacgggccc tgcacagggatcacacggctgcagcgctggcatcgggccgagcagatgggcttggagccc cccgccgaagtgcgccaggtgctgcagacccaccctggagatccccgcttccagtacagc ctctggcatgtctatcccctttga

DBGET integrated database retrieval system