Puma yagouaroundi (jaguarundi): 121023965 Help Entry 121023965         CDS       T07555                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04010   MAPK signaling pathway pyu04014   Ras signaling pathway pyu04015   Rap1 signaling pathway pyu04022   cGMP-PKG signaling pathway pyu04066   HIF-1 signaling pathway pyu04068   FoxO signaling pathway pyu04072   Phospholipase D signaling pathway pyu04081   Hormone signaling pyu04114   Oocyte meiosis pyu04140   Autophagy - animal pyu04150   mTOR signaling pathway pyu04151   PI3K-Akt signaling pathway pyu04152   AMPK signaling pathway pyu04211   Longevity regulating pathway pyu04213   Longevity regulating pathway - multiple species pyu04810   Regulation of actin cytoskeleton pyu04910   Insulin signaling pathway pyu04911   Insulin secretion pyu04913   Ovarian steroidogenesis pyu04914   Progesterone-mediated oocyte maturation pyu04917   Prolactin signaling pathway pyu04923   Regulation of lipolysis in adipocytes pyu04930   Type II diabetes mellitus pyu04931   Insulin resistance pyu04932   Non-alcoholic fatty liver disease pyu04940   Type I diabetes mellitus pyu04950   Maturity onset diabetes of the young pyu04960   Aldosterone-regulated sodium reabsorption pyu05010   Alzheimer disease pyu05215   Prostate cancer pyu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121023965 (INS)    04015 Rap1 signaling pathway     121023965 (INS)    04066 HIF-1 signaling pathway     121023965 (INS)    04068 FoxO signaling pathway     121023965 (INS)    04072 Phospholipase D signaling pathway     121023965 (INS)    04022 cGMP-PKG signaling pathway     121023965 (INS)    04151 PI3K-Akt signaling pathway     121023965 (INS)    04152 AMPK signaling pathway     121023965 (INS)    04150 mTOR signaling pathway     121023965 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     121023965 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121023965 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     121023965 (INS)    04923 Regulation of lipolysis in adipocytes     121023965 (INS)    04913 Ovarian steroidogenesis     121023965 (INS)    04917 Prolactin signaling pathway     121023965 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     121023965 (INS)   09149 Aging    04211 Longevity regulating pathway     121023965 (INS)    04213 Longevity regulating pathway - multiple species     121023965 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     121023965 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     121023965 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     121023965 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     121023965 (INS)    04940 Type I diabetes mellitus     121023965 (INS)    04950 Maturity onset diabetes of the young     121023965 (INS)    04932 Non-alcoholic fatty liver disease     121023965 (INS)    04931 Insulin resistance     121023965 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121023965 (INS) Cytokines and neuropeptides [BR:pyu04052]  Neuropeptides   Unclassified    121023965 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  121023965 NCBI-ProteinID:  XP_040322184 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MALWTRLLPLLVLLSLWTPAPTRAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAED LQGKDAELGEAPGAGGLQPSALEAPLQKRGIVEQCCASVCSLYQLEHYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacgcgcctcctgcccctgctggtgttgctgtccctctggacccctgcc ccgacccgagccttcgtcaaccagcacctgtgcggctcccacctggtggaggcgctgtac ctggtgtgcggggagcgcggcttcttctacacgcccaaggcccgccgggaggcggaggac cttcaggggaaggacgcggagctaggggaggcgcctggcgcgggcggcctgcagccctcg gccctggaggcgcccctgcagaagcggggcatcgtggagcaatgctgtgccagtgtctgc tcgctgtaccagctggagcattactgcaactag

DBGET integrated database retrieval system