Herpailurus yagouaroundi (jaguarundi): 121026749 Help Entry 121026749         CDS       T07555                                  Name (RefSeq) serum amyloid A protein   KO K17310   serum amyloid A protein Organism pyu  Herpailurus yagouaroundi (jaguarundi) Brite KEGG Orthology (KO) [BR:pyu00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyu04147]     121026749 Exosome [BR:pyu04147]  Exosomal proteins   Exosomal proteins of other cancer cells    121026749 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SAA PMSI1 Motif Other DBs NCBI-GeneID:  121026749 NCBI-ProteinID:  XP_040325457 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISNARENSQRVTDFFRHGS SGHGAEDSKADQAANEWGRSGKDPNHFRPAGLPDKY NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtggagagcctactctgacatgagagaagccaattacaaaggtgcagacaaatacttc cacgcccgggggaactatgatgccgcacagaggggacctgggggcgcttgggcggccaaa gtgatcagcaacgccagagagaattctcagagagtcacagactttttcaggcacggaagc agcggccacggagcagaggactcgaaggctgaccaggccgccaatgaatggggccggagc ggcaaagaccccaaccactttcgacctgctggcctgcctgacaagtactga

DBGET integrated database retrieval system