Puma yagouaroundi (jaguarundi): 121027214 Help Entry 121027214         CDS       T07555                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu01522   Endocrine resistance pyu04010   MAPK signaling pathway pyu04012   ErbB signaling pathway pyu04024   cAMP signaling pathway pyu04137   Mitophagy - animal pyu04210   Apoptosis pyu04310   Wnt signaling pathway pyu04380   Osteoclast differentiation pyu04510   Focal adhesion pyu04530   Tight junction pyu04620   Toll-like receptor signaling pathway pyu04621   NOD-like receptor signaling pathway pyu04625   C-type lectin receptor signaling pathway pyu04657   IL-17 signaling pathway pyu04658   Th1 and Th2 cell differentiation pyu04659   Th17 cell differentiation pyu04660   T cell receptor signaling pathway pyu04662   B cell receptor signaling pathway pyu04668   TNF signaling pathway pyu04722   Neurotrophin signaling pathway pyu04912   GnRH signaling pathway pyu04915   Estrogen signaling pathway pyu04921   Oxytocin signaling pathway pyu04926   Relaxin signaling pathway pyu04932   Non-alcoholic fatty liver disease pyu04933   AGE-RAGE signaling pathway in diabetic complications pyu05030   Cocaine addiction pyu05031   Amphetamine addiction pyu05132   Salmonella infection pyu05133   Pertussis pyu05135   Yersinia infection pyu05140   Leishmaniasis pyu05142   Chagas disease pyu05161   Hepatitis B pyu05162   Measles pyu05166   Human T-cell leukemia virus 1 infection pyu05167   Kaposi sarcoma-associated herpesvirus infection pyu05169   Epstein-Barr virus infection pyu05170   Human immunodeficiency virus 1 infection pyu05171   Coronavirus disease - COVID-19 pyu05200   Pathways in cancer pyu05203   Viral carcinogenesis pyu05207   Chemical carcinogenesis - receptor activation pyu05208   Chemical carcinogenesis - reactive oxygen species pyu05210   Colorectal cancer pyu05211   Renal cell carcinoma pyu05224   Breast cancer pyu05231   Choline metabolism in cancer pyu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pyu05321   Inflammatory bowel disease pyu05323   Rheumatoid arthritis pyu05417   Lipid and atherosclerosis pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121027214 (JUN)    04012 ErbB signaling pathway     121027214 (JUN)    04310 Wnt signaling pathway     121027214 (JUN)    04668 TNF signaling pathway     121027214 (JUN)    04024 cAMP signaling pathway     121027214 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     121027214 (JUN)   09143 Cell growth and death    04210 Apoptosis     121027214 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     121027214 (JUN)    04530 Tight junction     121027214 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121027214 (JUN)    04621 NOD-like receptor signaling pathway     121027214 (JUN)    04625 C-type lectin receptor signaling pathway     121027214 (JUN)    04660 T cell receptor signaling pathway     121027214 (JUN)    04658 Th1 and Th2 cell differentiation     121027214 (JUN)    04659 Th17 cell differentiation     121027214 (JUN)    04657 IL-17 signaling pathway     121027214 (JUN)    04662 B cell receptor signaling pathway     121027214 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     121027214 (JUN)    04915 Estrogen signaling pathway     121027214 (JUN)    04921 Oxytocin signaling pathway     121027214 (JUN)    04926 Relaxin signaling pathway     121027214 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     121027214 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     121027214 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121027214 (JUN)    05207 Chemical carcinogenesis - receptor activation     121027214 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     121027214 (JUN)    05203 Viral carcinogenesis     121027214 (JUN)    05231 Choline metabolism in cancer     121027214 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121027214 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     121027214 (JUN)    05211 Renal cell carcinoma     121027214 (JUN)    05224 Breast cancer     121027214 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121027214 (JUN)    05170 Human immunodeficiency virus 1 infection     121027214 (JUN)    05161 Hepatitis B     121027214 (JUN)    05171 Coronavirus disease - COVID-19     121027214 (JUN)    05162 Measles     121027214 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     121027214 (JUN)    05169 Epstein-Barr virus infection     121027214 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     121027214 (JUN)    05135 Yersinia infection     121027214 (JUN)    05133 Pertussis     121027214 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     121027214 (JUN)    05142 Chagas disease     121027214 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     121027214 (JUN)    05321 Inflammatory bowel disease     121027214 (JUN)   09165 Substance dependence    05030 Cocaine addiction     121027214 (JUN)    05031 Amphetamine addiction     121027214 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121027214 (JUN)    05418 Fluid shear stress and atherosclerosis     121027214 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     121027214 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     121027214 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     121027214 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pyu03000]     121027214 (JUN) Transcription factors [BR:pyu03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     121027214 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  121027214 NCBI-ProteinID:  XP_040326343 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggtgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcatggtggctccggcggtggcttcggcggcgggcggcagcggcagcggtggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgct ctgagcagcggcggtggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg cagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaatatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system