Herpailurus yagouaroundi (jaguarundi): 121027738 Help Entry 121027738         CDS       T07555                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu01521   EGFR tyrosine kinase inhibitor resistance pyu01522   Endocrine resistance pyu04010   MAPK signaling pathway pyu04012   ErbB signaling pathway pyu04014   Ras signaling pathway pyu04015   Rap1 signaling pathway pyu04062   Chemokine signaling pathway pyu04068   FoxO signaling pathway pyu04071   Sphingolipid signaling pathway pyu04072   Phospholipase D signaling pathway pyu04137   Mitophagy - animal pyu04140   Autophagy - animal pyu04150   mTOR signaling pathway pyu04151   PI3K-Akt signaling pathway pyu04210   Apoptosis pyu04211   Longevity regulating pathway pyu04213   Longevity regulating pathway - multiple species pyu04218   Cellular senescence pyu04360   Axon guidance pyu04370   VEGF signaling pathway pyu04371   Apelin signaling pathway pyu04540   Gap junction pyu04550   Signaling pathways regulating pluripotency of stem cells pyu04625   C-type lectin receptor signaling pathway pyu04650   Natural killer cell mediated cytotoxicity pyu04660   T cell receptor signaling pathway pyu04662   B cell receptor signaling pathway pyu04664   Fc epsilon RI signaling pathway pyu04714   Thermogenesis pyu04720   Long-term potentiation pyu04722   Neurotrophin signaling pathway pyu04725   Cholinergic synapse pyu04726   Serotonergic synapse pyu04730   Long-term depression pyu04810   Regulation of actin cytoskeleton pyu04910   Insulin signaling pathway pyu04912   GnRH signaling pathway pyu04915   Estrogen signaling pathway pyu04916   Melanogenesis pyu04917   Prolactin signaling pathway pyu04919   Thyroid hormone signaling pathway pyu04921   Oxytocin signaling pathway pyu04926   Relaxin signaling pathway pyu04929   GnRH secretion pyu04933   AGE-RAGE signaling pathway in diabetic complications pyu04935   Growth hormone synthesis, secretion and action pyu05010   Alzheimer disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05034   Alcoholism pyu05160   Hepatitis C pyu05161   Hepatitis B pyu05163   Human cytomegalovirus infection pyu05165   Human papillomavirus infection pyu05166   Human T-cell leukemia virus 1 infection pyu05167   Kaposi sarcoma-associated herpesvirus infection pyu05170   Human immunodeficiency virus 1 infection pyu05200   Pathways in cancer pyu05203   Viral carcinogenesis pyu05205   Proteoglycans in cancer pyu05206   MicroRNAs in cancer pyu05207   Chemical carcinogenesis - receptor activation pyu05208   Chemical carcinogenesis - reactive oxygen species pyu05210   Colorectal cancer pyu05211   Renal cell carcinoma pyu05213   Endometrial cancer pyu05214   Glioma pyu05215   Prostate cancer pyu05216   Thyroid cancer pyu05218   Melanoma pyu05219   Bladder cancer pyu05220   Chronic myeloid leukemia pyu05221   Acute myeloid leukemia pyu05223   Non-small cell lung cancer pyu05224   Breast cancer pyu05225   Hepatocellular carcinoma pyu05226   Gastric cancer pyu05230   Central carbon metabolism in cancer pyu05231   Choline metabolism in cancer pyu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pyu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121027738 (NRAS)    04012 ErbB signaling pathway     121027738 (NRAS)    04014 Ras signaling pathway     121027738 (NRAS)    04015 Rap1 signaling pathway     121027738 (NRAS)    04370 VEGF signaling pathway     121027738 (NRAS)    04371 Apelin signaling pathway     121027738 (NRAS)    04068 FoxO signaling pathway     121027738 (NRAS)    04072 Phospholipase D signaling pathway     121027738 (NRAS)    04071 Sphingolipid signaling pathway     121027738 (NRAS)    04151 PI3K-Akt signaling pathway     121027738 (NRAS)    04150 mTOR signaling pathway     121027738 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121027738 (NRAS)    04137 Mitophagy - animal     121027738 (NRAS)   09143 Cell growth and death    04210 Apoptosis     121027738 (NRAS)    04218 Cellular senescence     121027738 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     121027738 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     121027738 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121027738 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121027738 (NRAS)    04650 Natural killer cell mediated cytotoxicity     121027738 (NRAS)    04660 T cell receptor signaling pathway     121027738 (NRAS)    04662 B cell receptor signaling pathway     121027738 (NRAS)    04664 Fc epsilon RI signaling pathway     121027738 (NRAS)    04062 Chemokine signaling pathway     121027738 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     121027738 (NRAS)    04929 GnRH secretion     121027738 (NRAS)    04912 GnRH signaling pathway     121027738 (NRAS)    04915 Estrogen signaling pathway     121027738 (NRAS)    04917 Prolactin signaling pathway     121027738 (NRAS)    04921 Oxytocin signaling pathway     121027738 (NRAS)    04926 Relaxin signaling pathway     121027738 (NRAS)    04935 Growth hormone synthesis, secretion and action     121027738 (NRAS)    04919 Thyroid hormone signaling pathway     121027738 (NRAS)    04916 Melanogenesis     121027738 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     121027738 (NRAS)    04726 Serotonergic synapse     121027738 (NRAS)    04720 Long-term potentiation     121027738 (NRAS)    04730 Long-term depression     121027738 (NRAS)    04722 Neurotrophin signaling pathway     121027738 (NRAS)   09158 Development and regeneration    04360 Axon guidance     121027738 (NRAS)   09149 Aging    04211 Longevity regulating pathway     121027738 (NRAS)    04213 Longevity regulating pathway - multiple species     121027738 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     121027738 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121027738 (NRAS)    05206 MicroRNAs in cancer     121027738 (NRAS)    05205 Proteoglycans in cancer     121027738 (NRAS)    05207 Chemical carcinogenesis - receptor activation     121027738 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     121027738 (NRAS)    05203 Viral carcinogenesis     121027738 (NRAS)    05230 Central carbon metabolism in cancer     121027738 (NRAS)    05231 Choline metabolism in cancer     121027738 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121027738 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     121027738 (NRAS)    05225 Hepatocellular carcinoma     121027738 (NRAS)    05226 Gastric cancer     121027738 (NRAS)    05214 Glioma     121027738 (NRAS)    05216 Thyroid cancer     121027738 (NRAS)    05221 Acute myeloid leukemia     121027738 (NRAS)    05220 Chronic myeloid leukemia     121027738 (NRAS)    05218 Melanoma     121027738 (NRAS)    05211 Renal cell carcinoma     121027738 (NRAS)    05219 Bladder cancer     121027738 (NRAS)    05215 Prostate cancer     121027738 (NRAS)    05213 Endometrial cancer     121027738 (NRAS)    05224 Breast cancer     121027738 (NRAS)    05223 Non-small cell lung cancer     121027738 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121027738 (NRAS)    05170 Human immunodeficiency virus 1 infection     121027738 (NRAS)    05161 Hepatitis B     121027738 (NRAS)    05160 Hepatitis C     121027738 (NRAS)    05163 Human cytomegalovirus infection     121027738 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     121027738 (NRAS)    05165 Human papillomavirus infection     121027738 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     121027738 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     121027738 (NRAS)   09165 Substance dependence    05034 Alcoholism     121027738 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121027738 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     121027738 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     121027738 (NRAS)    01522 Endocrine resistance     121027738 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pyu04131]     121027738 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyu04147]     121027738 (NRAS)    04031 GTP-binding proteins [BR:pyu04031]     121027738 (NRAS) Membrane trafficking [BR:pyu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     121027738 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     121027738 (NRAS) Exosome [BR:pyu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121027738 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    121027738 (NRAS)   Exosomal proteins of breast cancer cells    121027738 (NRAS)   Exosomal proteins of colorectal cancer cells    121027738 (NRAS) GTP-binding proteins [BR:pyu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121027738 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  121027738 NCBI-ProteinID:  XP_040327327 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt aagcgagtaaaagactccgatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggaccgtcgacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system