Herpailurus yagouaroundi (jaguarundi): 121028615 Help Entry 121028615         CDS       T07555                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu04024   cAMP signaling pathway pyu04080   Neuroactive ligand-receptor interaction pyu04920   Adipocytokine signaling pathway pyu04923   Regulation of lipolysis in adipocytes pyu05034   Alcoholism Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     121028615 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     121028615 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     121028615 (NPY)    04920 Adipocytokine signaling pathway     121028615 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     121028615 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121028615 (NPY) Cytokines and neuropeptides [BR:pyu04052]  Neuropeptides   GPCR binding    121028615 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  121028615 NCBI-ProteinID:  XP_040328359 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MLGSKRLGLSGMTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgggtagcaagcgactggggctctccggaatgaccctcgccctgtccctgcttgtg tgcctgggcgcgctggccgaggcatacccctccaaaccagacaacccaggagaggacgcg ccggcagaggacatggccagatactattcagcgctgcgacactacatcaacctcatcacc aggcagaggtatggaaaacgatctagccctgagacactgatttcagacctcttgatgaga gaaagcacagaaaacgttcccagaactaggctggaagacccttctatgtggtga

DBGET integrated database retrieval system