Puma yagouaroundi (jaguarundi): 121030128 Help Entry 121030128         CDS       T07555                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04151   PI3K-Akt signaling pathway pyu04625   C-type lectin receptor signaling pathway pyu04630   JAK-STAT signaling pathway pyu04658   Th1 and Th2 cell differentiation pyu04659   Th17 cell differentiation pyu04660   T cell receptor signaling pathway pyu04672   Intestinal immune network for IgA production pyu04940   Type I diabetes mellitus pyu05135   Yersinia infection pyu05142   Chagas disease pyu05162   Measles pyu05166   Human T-cell leukemia virus 1 infection pyu05171   Coronavirus disease - COVID-19 pyu05200   Pathways in cancer pyu05320   Autoimmune thyroid disease pyu05321   Inflammatory bowel disease pyu05330   Allograft rejection pyu05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121030128 (IL2)    04151 PI3K-Akt signaling pathway     121030128 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121030128 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     121030128 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121030128 (IL2)    04660 T cell receptor signaling pathway     121030128 (IL2)    04658 Th1 and Th2 cell differentiation     121030128 (IL2)    04659 Th17 cell differentiation     121030128 (IL2)    04672 Intestinal immune network for IgA production     121030128 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121030128 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121030128 (IL2)    05171 Coronavirus disease - COVID-19     121030128 (IL2)    05162 Measles     121030128 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     121030128 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     121030128 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     121030128 (IL2)    05321 Inflammatory bowel disease     121030128 (IL2)    05330 Allograft rejection     121030128 (IL2)    05332 Graft-versus-host disease     121030128 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     121030128 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121030128 (IL2)    00536 Glycosaminoglycan binding proteins [BR:pyu00536]     121030128 (IL2) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Interleukins    121030128 (IL2) Glycosaminoglycan binding proteins [BR:pyu00536]  Heparan sulfate / Heparin   Cytokines    121030128 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Leg1 Motif Other DBs NCBI-GeneID:  121030128 NCBI-ProteinID:  XP_040330563 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML TFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS ETRFTCKYDDETATIVEFLNKWITFCQSIFSTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaattcaactcttgtcttgcattgcactgactcttatactcgtcacaaacagt gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc acatttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct gaaacaagattcacatgtaaatatgatgatgagacagcaaccattgtagaatttctgaac aaatggattaccttttgtcaaagcatcttctcaacgctgacttga

DBGET integrated database retrieval system