Herpailurus yagouaroundi (jaguarundi): 121030439 Help Entry 121030439         CDS       T07555                                  Symbol DBI Name (RefSeq) acyl-CoA-binding protein   KO K08762   diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu03320   PPAR signaling pathway Brite KEGG Orthology (KO) [BR:pyu00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     121030439 (DBI)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121030439 (DBI) Cytokines and neuropeptides [BR:pyu04052]  Neuropeptides   Unclassified    121030439 (DBI) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ACBP FERM_M Motif Other DBs NCBI-GeneID:  121030439 NCBI-ProteinID:  XP_040330801 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MSQAEFDKAAEDVKHLKTKPADDEMLFIYGHYKQATVGDINTERPGLLDLKGKAKWDAWN QLKGTSKEDAMKAYINKVEELKKKYGI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctcaggctgagtttgacaaagctgctgaggatgttaagcacctcaagaccaagcca gcagatgatgagatgttgttcatctacggccactacaaacaagcaaccgtgggtgacata aacacagaacggcctggactgttggatctcaaaggcaaggccaagtgggatgcctggaat cagctgaaagggacttccaaggaagatgccatgaaagcttacatcaacaaagtagaagag ctaaagaaaaaatacggaatataa

DBGET integrated database retrieval system