Herpailurus yagouaroundi (jaguarundi): 121031656 Help Entry 121031656         CDS       T07555                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu04024   cAMP signaling pathway pyu04062   Chemokine signaling pathway pyu04064   NF-kappa B signaling pathway pyu04210   Apoptosis pyu04380   Osteoclast differentiation pyu04620   Toll-like receptor signaling pathway pyu04621   NOD-like receptor signaling pathway pyu04622   RIG-I-like receptor signaling pathway pyu04623   Cytosolic DNA-sensing pathway pyu04625   C-type lectin receptor signaling pathway pyu04657   IL-17 signaling pathway pyu04658   Th1 and Th2 cell differentiation pyu04659   Th17 cell differentiation pyu04660   T cell receptor signaling pathway pyu04662   B cell receptor signaling pathway pyu04668   TNF signaling pathway pyu04722   Neurotrophin signaling pathway pyu04920   Adipocytokine signaling pathway pyu04926   Relaxin signaling pathway pyu04931   Insulin resistance pyu04936   Alcoholic liver disease pyu05132   Salmonella infection pyu05134   Legionellosis pyu05135   Yersinia infection pyu05140   Leishmaniasis pyu05142   Chagas disease pyu05145   Toxoplasmosis pyu05160   Hepatitis C pyu05161   Hepatitis B pyu05162   Measles pyu05163   Human cytomegalovirus infection pyu05164   Influenza A pyu05166   Human T-cell leukemia virus 1 infection pyu05167   Kaposi sarcoma-associated herpesvirus infection pyu05168   Herpes simplex virus 1 infection pyu05169   Epstein-Barr virus infection pyu05170   Human immunodeficiency virus 1 infection pyu05171   Coronavirus disease - COVID-19 pyu05200   Pathways in cancer pyu05203   Viral carcinogenesis pyu05208   Chemical carcinogenesis - reactive oxygen species pyu05215   Prostate cancer pyu05220   Chronic myeloid leukemia pyu05222   Small cell lung cancer pyu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pyu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     121031656 (NFKBIA)    04668 TNF signaling pathway     121031656 (NFKBIA)    04024 cAMP signaling pathway     121031656 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     121031656 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121031656 (NFKBIA)    04621 NOD-like receptor signaling pathway     121031656 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     121031656 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     121031656 (NFKBIA)    04625 C-type lectin receptor signaling pathway     121031656 (NFKBIA)    04660 T cell receptor signaling pathway     121031656 (NFKBIA)    04658 Th1 and Th2 cell differentiation     121031656 (NFKBIA)    04659 Th17 cell differentiation     121031656 (NFKBIA)    04657 IL-17 signaling pathway     121031656 (NFKBIA)    04662 B cell receptor signaling pathway     121031656 (NFKBIA)    04062 Chemokine signaling pathway     121031656 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     121031656 (NFKBIA)    04926 Relaxin signaling pathway     121031656 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     121031656 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     121031656 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121031656 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     121031656 (NFKBIA)    05203 Viral carcinogenesis     121031656 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121031656 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     121031656 (NFKBIA)    05215 Prostate cancer     121031656 (NFKBIA)    05222 Small cell lung cancer     121031656 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121031656 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     121031656 (NFKBIA)    05161 Hepatitis B     121031656 (NFKBIA)    05160 Hepatitis C     121031656 (NFKBIA)    05171 Coronavirus disease - COVID-19     121031656 (NFKBIA)    05164 Influenza A     121031656 (NFKBIA)    05162 Measles     121031656 (NFKBIA)    05168 Herpes simplex virus 1 infection     121031656 (NFKBIA)    05163 Human cytomegalovirus infection     121031656 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     121031656 (NFKBIA)    05169 Epstein-Barr virus infection     121031656 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     121031656 (NFKBIA)    05135 Yersinia infection     121031656 (NFKBIA)    05134 Legionellosis     121031656 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     121031656 (NFKBIA)    05140 Leishmaniasis     121031656 (NFKBIA)    05142 Chagas disease     121031656 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121031656 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121031656 (NFKBIA)    04931 Insulin resistance     121031656 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pyu03000]     121031656 (NFKBIA)    04131 Membrane trafficking [BR:pyu04131]     121031656 (NFKBIA) Transcription factors [BR:pyu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     121031656 (NFKBIA) Membrane trafficking [BR:pyu04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     121031656 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  121031656 NCBI-ProteinID:  XP_040332875 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGTEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaacccgccgagcacgcccaggactgggccatggagggtccccgggacgcgctc aagaaagagcggctcctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgggagatccggcttgagccccaggaggcgccg cgcggcaccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcattgaccatggaagtagtccgccaagtgaaaggagac ctggccttcctcaatttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacacctcgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctactccatcttgcaggccaccaac tacaatggtcacacatgtctacacttagcctctatccatggctacctgggcatcgtggag cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaactgcc ctccaccttgcagtggacctgcagaattccgacctcgtgtcgcttttgttgaagtgcggg gctgatgtcaacagagtcacctaccaaggctactccccgtaccagctcacctggggccgt ccaagtacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagtgaggatgaggagagctacgacacggagtcagagttcacagaggacgagctg ccctatgatgactgtgtgcttggaggccaacgcctgacgttatga

DBGET integrated database retrieval system