Herpailurus yagouaroundi (jaguarundi): 121033616 Help Entry 121033616         CDS       T07555                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu04014   Ras signaling pathway pyu04137   Mitophagy - animal pyu04144   Endocytosis pyu04145   Phagosome pyu04148   Efferocytosis pyu04962   Vasopressin-regulated water reabsorption pyu05014   Amyotrophic lateral sclerosis pyu05022   Pathways of neurodegeneration - multiple diseases pyu05132   Salmonella infection pyu05146   Amoebiasis pyu05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121033616 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121033616 (RAB5A)    04145 Phagosome     121033616 (RAB5A)    04137 Mitophagy - animal     121033616 (RAB5A)    04148 Efferocytosis     121033616 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     121033616 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121033616 (RAB5A)    05152 Tuberculosis     121033616 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     121033616 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121033616 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     121033616 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pyu04131]     121033616 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyu04147]     121033616 (RAB5A)    04031 GTP-binding proteins [BR:pyu04031]     121033616 (RAB5A) Membrane trafficking [BR:pyu04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     121033616 (RAB5A)  Endosome - Lysosome transport     121033616 (RAB5A) Exosome [BR:pyu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121033616 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    121033616 (RAB5A)   Exosomal proteins of colorectal cancer cells    121033616 (RAB5A)   Exosomal proteins of bladder cancer cells    121033616 (RAB5A) GTP-binding proteins [BR:pyu04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     121033616 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  121033616 NCBI-ProteinID:  XP_040336028 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccataggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgttgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggacgaggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system