Puma yagouaroundi (jaguarundi): 121034136 Help Entry 121034136         CDS       T07555                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04024   cAMP signaling pathway pyu04080   Neuroactive ligand-receptor interaction pyu04935   Growth hormone synthesis, secretion and action pyu04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     121034136 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     121034136 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     121034136 (SST)   09154 Digestive system    04971 Gastric acid secretion     121034136 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121034136 (SST) Cytokines and neuropeptides [BR:pyu04052]  Neuropeptides   Neuropeptides (GPCR binding)    121034136 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  121034136 NCBI-ProteinID:  XP_040337002 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctgtccatcgtcctggctctgggc ggtgtcaccggcgcgccctccgatcctcgactccgtcagtttctgcagaagtccctggct gctgccgcggggaagcaggaactggccaagtacttcttggcggagctgctgtctgaaccc aaccagacagagaacgatgccctggaacccgaagacttgtcccaggcggctgagcaggat gaaatgaggctggaactgcagagatccactaactcaaaccctgccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacttcctgttag

DBGET integrated database retrieval system