Puma yagouaroundi (jaguarundi): 121034467 Help Entry 121034467         CDS       T07555                                  Symbol CXCL6 Name (RefSeq) C-X-C motif chemokine 6   KO K05506   C-X-C motif chemokine 5/6 Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04060   Cytokine-cytokine receptor interaction pyu04061   Viral protein interaction with cytokine and cytokine receptor pyu04062   Chemokine signaling pathway pyu04657   IL-17 signaling pathway pyu04668   TNF signaling pathway pyu05133   Pertussis pyu05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     121034467 (CXCL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121034467 (CXCL6)    04061 Viral protein interaction with cytokine and cytokine receptor     121034467 (CXCL6)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     121034467 (CXCL6)    04062 Chemokine signaling pathway     121034467 (CXCL6)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     121034467 (CXCL6)   09163 Immune disease    05323 Rheumatoid arthritis     121034467 (CXCL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pyu04052]     121034467 (CXCL6) Cytokines and neuropeptides [BR:pyu04052]  Cytokines   Chemokines    121034467 (CXCL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  121034467 NCBI-ProteinID:  XP_040337184 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MSLPPSRAARAPRLSGSLCALLLLLLLLTPPGPLASAGPVAVIVRELRCVCLTTTPGIHP KMIAKMQVIGAGPQCPKVEVIATLKNKKEVCLDPETPVMKKAIQKILDSGKKAD NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagcctcccgccgagccgcgccgcccgcgccccgcgcctttcgggctctctgtgcgcg ctgctcctgctgctgctgctgctgacgccgccggggcccctcgccagcgccggtcccgtc gcggtcatagtgagggagctgcgttgcgtgtgtttaaccaccacaccggggattcatccc aaaatgatcgctaagatgcaggtgatcggggccgggccacagtgtcccaaggtggaagtc atagccaccctgaagaacaagaaggaagtctgtctggacccagaaacccctgtgatgaag aaagccatccagaaaatcttagacagtgggaaaaaggctgattaa

DBGET integrated database retrieval system