Puma yagouaroundi (jaguarundi): 121034821 Help Entry 121034821         CDS       T07555                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04621   NOD-like receptor signaling pathway pyu05012   Parkinson disease pyu05132   Salmonella infection pyu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pyu00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121034821 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121034821 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     121034821 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121034821 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pyu03110]     121034821 (TXN) Chaperones and folding catalysts [BR:pyu03110]  Protein folding catalysts   Protein disulfide isomerase    121034821 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  121034821 NCBI-ProteinID:  XP_040337874 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccttgaacagtgcaggggaa aaacttgtagtagttgatttctctgccacgtggtgtggaccttgcaaaatgatcaagccc ttctttcattccctctctgagaagtattccaacgtggtgttccttgaagtagacgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagctacc atcaatgaattaatctaa

DBGET integrated database retrieval system