Herpailurus yagouaroundi (jaguarundi): 121035882 Help Entry 121035882         CDS       T07555                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism pyu  Herpailurus yagouaroundi (jaguarundi) Brite KEGG Orthology (KO) [BR:pyu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:pyu01002]     121035882 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyu04147]     121035882 (CSTB) Peptidases and inhibitors [BR:pyu01002]  Peptidase inhibitors   Family I25: cystatin family    121035882 (CSTB) Exosome [BR:pyu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    121035882 (CSTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin SQAPI Dynein_light Motif Other DBs NCBI-GeneID:  121035882 NCBI-ProteinID:  XP_040339731 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MMCGAPSATQPATAETQAIADQVKPQLEEQENKKYTTFKAVEFRSQVVAGRNYFIKVQVD DEEFVHIRVFQSLPHENKPLALSSYQTHKARHDELAYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggcgccctccgccacgcagcccgccacggccgagacccaggccatcgcc gaccaggtgaagccccagctggaggagcaggagaataagaagtacactacctttaaggcg gtggagttcaggagccaggtggtcgcagggaggaactacttcatcaaggttcaagtcgat gatgaggagtttgtgcacattcgagtgtttcagagtctcccgcacgaaaacaaacccttg gccttgtccagctatcagacccacaaagccaggcacgacgaactggcgtatttctag

DBGET integrated database retrieval system