Puma yagouaroundi (jaguarundi): 121036018 Help Entry 121036018         CDS       T07555                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism pyu  Puma yagouaroundi (jaguarundi) Pathway pyu04146   Peroxisome pyu04213   Longevity regulating pathway - multiple species pyu05012   Parkinson disease pyu05014   Amyotrophic lateral sclerosis pyu05016   Huntington disease pyu05020   Prion disease pyu05022   Pathways of neurodegeneration - multiple diseases pyu05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:pyu00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     121036018 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     121036018 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     121036018 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     121036018 (SOD1)    05014 Amyotrophic lateral sclerosis     121036018 (SOD1)    05016 Huntington disease     121036018 (SOD1)    05020 Prion disease     121036018 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     121036018 (SOD1) Enzymes [BR:pyu01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      121036018 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  121036018 NCBI-ProteinID:  XP_040340004 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGNGPVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVANVSMEDSLIALSGDHSIIGRTMVVH EKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgctgaagggccagggcccggtcgagggcaccatccac ttcgtacagaagggcaatgggcctgttgtggtatcaggaaccattacaggattgactgaa ggagagcatggattccacgtccatcagtttggagataatacacaaggctgtaccagtgca ggccctcactttaatcctctatccaaaaaacatggtgggccaaaagatcaagagaggcat gttggagaccttggcaatgtaactgctggcaaggacggtgtggccaacgtgtctatggaa gattctctgattgcgctctcaggagaccattccatcattggccgcacgatggtggtccac gagaaacgagatgacttgggcaaaggtggaaatgaagaaagtacgcaaacgggaaacgct gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system