Entry |
|
Symbol |
MAPK8
|
Name |
(RefSeq) mitogen-activated protein kinase 8 isoform X1
|
KO |
K04440 | mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] |
|
Organism |
pyu Puma yagouaroundi (jaguarundi)
|
Pathway |
pyu04141 | Protein processing in endoplasmic reticulum |
pyu04620 | Toll-like receptor signaling pathway |
pyu04621 | NOD-like receptor signaling pathway |
pyu04622 | RIG-I-like receptor signaling pathway |
pyu04625 | C-type lectin receptor signaling pathway |
pyu04658 | Th1 and Th2 cell differentiation |
pyu04660 | T cell receptor signaling pathway |
pyu04664 | Fc epsilon RI signaling pathway |
pyu04723 | Retrograde endocannabinoid signaling |
pyu04750 | Inflammatory mediator regulation of TRP channels |
pyu04914 | Progesterone-mediated oocyte maturation |
pyu04920 | Adipocytokine signaling pathway |
pyu04932 | Non-alcoholic fatty liver disease |
pyu04933 | AGE-RAGE signaling pathway in diabetic complications |
pyu04935 | Growth hormone synthesis, secretion and action |
pyu05022 | Pathways of neurodegeneration - multiple diseases |
pyu05166 | Human T-cell leukemia virus 1 infection |
pyu05167 | Kaposi sarcoma-associated herpesvirus infection |
pyu05170 | Human immunodeficiency virus 1 infection |
pyu05208 | Chemical carcinogenesis - reactive oxygen species |
pyu05418 | Fluid shear stress and atherosclerosis |
|
Brite |
KEGG Orthology (KO) [BR:pyu00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
121036923 (MAPK8)
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
121036923 (MAPK8)
04012 ErbB signaling pathway
121036923 (MAPK8)
04014 Ras signaling pathway
121036923 (MAPK8)
04310 Wnt signaling pathway
121036923 (MAPK8)
04668 TNF signaling pathway
121036923 (MAPK8)
04068 FoxO signaling pathway
121036923 (MAPK8)
04071 Sphingolipid signaling pathway
121036923 (MAPK8)
04024 cAMP signaling pathway
121036923 (MAPK8)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
121036923 (MAPK8)
04137 Mitophagy - animal
121036923 (MAPK8)
09143 Cell growth and death
04210 Apoptosis
121036923 (MAPK8)
04215 Apoptosis - multiple species
121036923 (MAPK8)
04217 Necroptosis
121036923 (MAPK8)
09144 Cellular community - eukaryotes
04510 Focal adhesion
121036923 (MAPK8)
04530 Tight junction
121036923 (MAPK8)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
121036923 (MAPK8)
04621 NOD-like receptor signaling pathway
121036923 (MAPK8)
04622 RIG-I-like receptor signaling pathway
121036923 (MAPK8)
04625 C-type lectin receptor signaling pathway
121036923 (MAPK8)
04660 T cell receptor signaling pathway
121036923 (MAPK8)
04658 Th1 and Th2 cell differentiation
121036923 (MAPK8)
04659 Th17 cell differentiation
121036923 (MAPK8)
04657 IL-17 signaling pathway
121036923 (MAPK8)
04664 Fc epsilon RI signaling pathway
121036923 (MAPK8)
09152 Endocrine system
04910 Insulin signaling pathway
121036923 (MAPK8)
04920 Adipocytokine signaling pathway
121036923 (MAPK8)
04912 GnRH signaling pathway
121036923 (MAPK8)
04914 Progesterone-mediated oocyte maturation
121036923 (MAPK8)
04917 Prolactin signaling pathway
121036923 (MAPK8)
04926 Relaxin signaling pathway
121036923 (MAPK8)
04935 Growth hormone synthesis, secretion and action
121036923 (MAPK8)
09156 Nervous system
04728 Dopaminergic synapse
121036923 (MAPK8)
04723 Retrograde endocannabinoid signaling
121036923 (MAPK8)
04722 Neurotrophin signaling pathway
121036923 (MAPK8)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
121036923 (MAPK8)
09158 Development and regeneration
04380 Osteoclast differentiation
121036923 (MAPK8)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
121036923 (MAPK8)
05208 Chemical carcinogenesis - reactive oxygen species
121036923 (MAPK8)
05231 Choline metabolism in cancer
121036923 (MAPK8)
09162 Cancer: specific types
05210 Colorectal cancer
121036923 (MAPK8)
05212 Pancreatic cancer
121036923 (MAPK8)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
121036923 (MAPK8)
05170 Human immunodeficiency virus 1 infection
121036923 (MAPK8)
05161 Hepatitis B
121036923 (MAPK8)
05171 Coronavirus disease - COVID-19
121036923 (MAPK8)
05162 Measles
121036923 (MAPK8)
05167 Kaposi sarcoma-associated herpesvirus infection
121036923 (MAPK8)
05169 Epstein-Barr virus infection
121036923 (MAPK8)
09171 Infectious disease: bacterial
05132 Salmonella infection
121036923 (MAPK8)
05135 Yersinia infection
121036923 (MAPK8)
05133 Pertussis
121036923 (MAPK8)
05152 Tuberculosis
121036923 (MAPK8)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
121036923 (MAPK8)
05142 Chagas disease
121036923 (MAPK8)
09164 Neurodegenerative disease
05010 Alzheimer disease
121036923 (MAPK8)
05012 Parkinson disease
121036923 (MAPK8)
05016 Huntington disease
121036923 (MAPK8)
05017 Spinocerebellar ataxia
121036923 (MAPK8)
05020 Prion disease
121036923 (MAPK8)
05022 Pathways of neurodegeneration - multiple diseases
121036923 (MAPK8)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
121036923 (MAPK8)
05418 Fluid shear stress and atherosclerosis
121036923 (MAPK8)
05415 Diabetic cardiomyopathy
121036923 (MAPK8)
09167 Endocrine and metabolic disease
04930 Type II diabetes mellitus
121036923 (MAPK8)
04936 Alcoholic liver disease
121036923 (MAPK8)
04932 Non-alcoholic fatty liver disease
121036923 (MAPK8)
04931 Insulin resistance
121036923 (MAPK8)
04933 AGE-RAGE signaling pathway in diabetic complications
121036923 (MAPK8)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
121036923 (MAPK8)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:pyu01001]
121036923 (MAPK8)
Enzymes [BR:pyu01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.24 mitogen-activated protein kinase
121036923 (MAPK8)
Protein kinases [BR:pyu01001]
Serine/threonine kinases: CMGC group
MAPK family [OT]
121036923 (MAPK8)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR |
NT seq |
1284 nt +upstreamnt +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattt
acagttttgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctgagccggccg
tttcagaatcagactcatgctaaacgggcttacagagagctagttctaatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtggtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttc
atgatgacgccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgccctgaattcatgaagaaactacaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggacttgttatccaaa
atgctggtaattgatgcatctaaaaggatctctgtagatgaagccctccagcatccatat
atcaatgtctggtatgatccttctgaagcagaagctccaccacccaagatacctgacaag
caattagatgaaagggaacatacaatagaagagtggaaagagttgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcagatacagatagcagtctggaagcatcagct
ggacctctgggctgttgtagatga |