Herpailurus yagouaroundi (jaguarundi): 121039745 Help Entry 121039745         CDS       T07555                                  Symbol MYL5 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu04360   Axon guidance pyu04510   Focal adhesion pyu04520   Adherens junction pyu04670   Leukocyte transendothelial migration pyu04810   Regulation of actin cytoskeleton pyu04814   Motor proteins pyu04820   Cytoskeleton in muscle cells pyu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pyu00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     121039745 (MYL5)    04520 Adherens junction     121039745 (MYL5)   09142 Cell motility    04814 Motor proteins     121039745 (MYL5)    04820 Cytoskeleton in muscle cells     121039745 (MYL5)    04810 Regulation of actin cytoskeleton     121039745 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     121039745 (MYL5)   09158 Development and regeneration    04360 Axon guidance     121039745 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121039745 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pyu04812]     121039745 (MYL5) Cytoskeleton proteins [BR:pyu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      121039745 (MYL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Lipoprotein_6 Caleosin Motif Other DBs NCBI-GeneID:  121039745 NCBI-ProteinID:  XP_040346040 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MASRKTKKKEGGGLRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA SLGKTNVKDDELDAMLKEASGPINFTMFLNMFGAKLTGTDAEETILNAFKMLDPEGKGSI NKDYIKRLLMSQADKMTAEEVDQMFQFATIDAAGNLDYKALSYVLTHGEEKEE NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggaagaccaagaagaaggaaggggggggccttcgggcccagagagcatca tccaacgtcttttccaactttgagcagacccagatccaggagttcaaggaggcattcaca ctgatggatcagaaccgagatggctttattgacaaggaggatctgaaggacacctatgcc tccctgggcaaaaccaacgtcaaggatgatgagttggatgccatgctcaaggaggcctca ggacccatcaacttcaccatgttcctgaatatgtttggggcgaagctgacgggtacggat gccgaagagaccatcctaaatgccttcaagatgctggatcctgaaggcaaaggcagcatc aacaaggactacatcaagcggctgttgatgtctcaggcagacaagatgaccgctgaagag gttgaccagatgttccagtttgccaccatcgatgctgcaggcaacctggactacaaggca ctgagctacgtgctcacccacggggaggagaaggaggagtga

DBGET integrated database retrieval system