Herpailurus yagouaroundi (jaguarundi): 121040953 Help Entry 121040953         CDS       T07555                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism pyu  Herpailurus yagouaroundi (jaguarundi) Pathway pyu04014   Ras signaling pathway pyu04137   Mitophagy - animal pyu04144   Endocytosis pyu04145   Phagosome pyu04148   Efferocytosis pyu04962   Vasopressin-regulated water reabsorption pyu05132   Salmonella infection pyu05146   Amoebiasis pyu05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pyu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121040953 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121040953 (RAB5B)    04145 Phagosome     121040953 (RAB5B)    04137 Mitophagy - animal     121040953 (RAB5B)    04148 Efferocytosis     121040953 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     121040953 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121040953 (RAB5B)    05152 Tuberculosis     121040953 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     121040953 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pyu04131]     121040953 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pyu04147]     121040953 (RAB5B)    04031 GTP-binding proteins [BR:pyu04031]     121040953 (RAB5B) Membrane trafficking [BR:pyu04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     121040953 (RAB5B)  Endosome - Lysosome transport     121040953 (RAB5B) Exosome [BR:pyu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121040953 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    121040953 (RAB5B)   Exosomal proteins of colorectal cancer cells    121040953 (RAB5B)   Exosomal proteins of melanoma cells    121040953 (RAB5B) GTP-binding proteins [BR:pyu04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     121040953 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  121040953 NCBI-ProteinID:  XP_040347711 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagtctggtattacgtttt gtcaaagggcagtttcatgagtaccaggagagcaccattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatttgggacacagctgggcaggag cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgggcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcggggaacaaagctgacctggccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgacctcttcctggcaatagctaagaag ctgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system